From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

FunGene: 08-OCT-2024

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_001930
  • pan locus tag?: SAUPAN004925000
  • symbol: JSNZ_001930
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_001930
  • symbol: JSNZ_001930
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1943641..1943787
  • length: 147
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    TTGATTGCTGACTTAGATGCAATCGAGGGTTTATTTATATCTATAGAAGTCATATTACTT
    TTAACTTTATTCATTGTACATGTTAATGGTAAAAATATTAATTTTATTAATGCGTTAGCT
    TTAATTATATTAAGGCAAACTGTATAA
    60
    120
    147

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: JSNZ_001930
  • symbol: JSNZ_001930
  • description: hypothetical protein
  • length: 48
  • theoretical pI: 4.53867
  • theoretical MW: 5319.42
  • GRAVY: 1.40417

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for NCTC8325
  • PFAM:

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0064
    • Cytoplasmic Membrane Score: 0.8887
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.1048
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.02063
    • TAT(Tat/SPI): 0.00062
    • LIPO(Sec/SPII): 0.006091
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

⊟Protein sequence[edit | edit source]

  • MIADLDAIEGLFISIEVILLLTLFIVHVNGKNINFINALALIILRQTV

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You can add further information about the gene and protein here.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=JSNZ_001930&oldid=107571"