Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_001432
- pan locus tag?: SAUPAN003906000
- symbol: JSNZ_001432
- pan gene symbol?: —
- synonym:
- product: YppE family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_001432
- symbol: JSNZ_001432
- product: YppE family protein
- replicon: chromosome
- strand: -
- coordinates: 1478085..1478435
- length: 351
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAATGATGTAGTCGAATCACTAATTTATGAAGTTAACAACATGCAACAAAATTTTGAA
AATGTGAAATCACAACAACAAGATCATGATTTTTACCAAACTGTAAAGCCATATACTGAA
CATATTGATAGCATGCTCAATGAGATCAAATTACATCGTGAATTTATTATAGAAGTACCT
TATATGAATTCAAGGAAATTTGAGCTACTGATTGCTAACATTGAACAACTTTCTGTCGAA
TGTCATTTTAAGCGAACAAGTCGAAAGTTATTTATAGAAAAGCTTAAAAGTGTTCAATAT
GATTTACAAAATATATTAGATGGCGTAACAAAAGAGGGTACTTATGGTTAA60
120
180
240
300
351
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_001432
- symbol: JSNZ_001432
- description: YppE family protein
- length: 116
- theoretical pI: 5.20066
- theoretical MW: 13848.6
- GRAVY: -0.587931
⊟Function[edit | edit source]
- TIGRFAM: Mobile and extrachromosomal element functions Prophage functions phage transcriptional regulator, RinA family (TIGR01636; HMM-score: 13.2)Regulatory functions DNA interactions phage transcriptional regulator, RinA family (TIGR01636; HMM-score: 13.2)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined DUF1798; Bacterial domain of unknown function (DUF1798) (PF08807; HMM-score: 110.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.5049
- Cytoplasmic Membrane Score: 0.4251
- Cell wall & surface Score: 0.0058
- Extracellular Score: 0.0641
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002083
- TAT(Tat/SPI): 0.000109
- LIPO(Sec/SPII): 0.00046
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MNDVVESLIYEVNNMQQNFENVKSQQQDHDFYQTVKPYTEHIDSMLNEIKLHREFIIEVPYMNSRKFELLIANIEQLSVECHFKRTSRKLFIEKLKSVQYDLQNILDGVTKEGTYG
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : gpsB < JSNZ_001431 < JSNZ_001432 < JSNZ_001433
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)