From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_001269
  • pan locus tag?: SAUPAN003609000
  • symbol: JSNZ_001269
  • pan gene symbol?: glpP
  • synonym:
  • product: glycerol-3-phosphate responsive antiterminator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_001269
  • symbol: JSNZ_001269
  • product: glycerol-3-phosphate responsive antiterminator
  • replicon: chromosome
  • strand: +
  • coordinates: 1285922..1286464
  • length: 543
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAATCAAGTGAATAACAACATATTGCCTGCCATAAGAAACATTAAAGATTTAGAGAAA
    CTGATTAAAACAGATTATAAAATGTGTGTGCTTCTAGATATGCATATAGGACATATAAAA
    AGTATTATGGAATTGCTGAAGCAAAATCATATAGAGTGTTTTATTCATATAGATTTGATA
    AAAGGTTTAAGCCACGATGAATTTGCAAGTGAATTTATTATTCAGCAATACAAGCCAAAA
    GGTATCGTATCGACTAAATCTAAAGTAATAAAAAAAGCTAAATCATTAAATACTTTAACG
    ATTTTTAGAGTATTTATTATTGATAGTCAAGCATTGAAACGCAGTATAGATTTGATAAAA
    AAAGTTGAACCTGATTTTGTTGAAGTACTTCCAGGTGTTGCGAGTAAAGCGATTCATCAT
    ATTCAGAAAGAAACAAACACACAAGTCATTGCAGGTGGCCTAATTAATACAATAGATGAA
    GTCAATGAAGCTGTTAAAAATGGAGCGAAATATGTAACAACTAGTTATGATAAACTTTGG
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    543

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JSNZ_001269
  • symbol: JSNZ_001269
  • description: glycerol-3-phosphate responsive antiterminator
  • length: 180
  • theoretical pI: 9.59463
  • theoretical MW: 20449.9
  • GRAVY: -0.06

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Amino acid biosynthesis Histidine family 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase (TIGR00007; EC 5.3.1.16; HMM-score: 18.8)
    Metabolism Amino acid biosynthesis Glutamate family 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (TIGR01182; EC 4.1.2.14,4.1.3.16; HMM-score: 16.3)
    Metabolism Energy metabolism Entner-Doudoroff 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase (TIGR01182; EC 4.1.2.14,4.1.3.16; HMM-score: 16.3)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    TIM_barrel (CL0036) G3P_antiterm; Glycerol-3-phosphate responsive antiterminator (PF04309; HMM-score: 205.7)
    and 1 more
    His_biosynth; Histidine biosynthesis protein (PF00977; HMM-score: 19.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9155
    • Cytoplasmic Membrane Score: 0.0274
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0571
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.000785
    • TAT(Tat/SPI): 0.000073
    • LIPO(Sec/SPII): 0.000133
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MNQVNNNILPAIRNIKDLEKLIKTDYKMCVLLDMHIGHIKSIMELLKQNHIECFIHIDLIKGLSHDEFASEFIIQQYKPKGIVSTKSKVIKKAKSLNTLTIFRVFIIDSQALKRSIDLIKKVEPDFVEVLPGVASKAIHHIQKETNTQVIAGGLINTIDEVNEAVKNGAKYVTTSYDKLW

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]