From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_001077
  • pan locus tag?: SAUPAN003339000
  • symbol: JSNZ_001077
  • pan gene symbol?: fpa
  • synonym: ylaN
  • product: DUF1507 family protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_001077
  • symbol: JSNZ_001077
  • product: DUF1507 family protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1080532..1080807
  • length: 276
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGGCGAAACAAGCAACAATGAAAAATGCAGCTTTGAAACAATTGACTAAAGATGCTGAT
    GAAATCTTGCATCTGATTAAAGTTCAACTAGATAATTTAACATTACCTTCATGCCCATTA
    TATGAAGAAGTACTAGATACACAAATGTTTGGACTTCAAAAAGAAGTTGATTTTGCTGTT
    AAATTAGGTTTAGTTGACCGCGAAGATGGCAAACAAATTATGTTACGTCTTGAGAAAGAA
    CTTTCAAAATTACATGAAGCTTTTACACTTGTTTAA
    60
    120
    180
    240
    276

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JSNZ_001077
  • symbol: JSNZ_001077
  • description: DUF1507 family protein
  • length: 91
  • theoretical pI: 5.13718
  • theoretical MW: 10355.1
  • GRAVY: -0.124176

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined DUF1507; Protein of unknown function (DUF1507) (PF07408; HMM-score: 124.8)
    and 2 more
    DUF2680; Protein of unknown function (DUF2680) (PF10925; HMM-score: 17.3)
    Nas2_N; Nas2 N_terminal domain (PF18265; HMM-score: 12.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8031
    • Cytoplasmic Membrane Score: 0.0376
    • Cell wall & surface Score: 0.0015
    • Extracellular Score: 0.1577
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.000996
    • TAT(Tat/SPI): 0.000153
    • LIPO(Sec/SPII): 0.000191
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MAKQATMKNAALKQLTKDADEILHLIKVQLDNLTLPSCPLYEEVLDTQMFGLQKEVDFAVKLGLVDREDGKQIMLRLEKELSKLHEAFTLV

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]