Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_001062
- pan locus tag?: SAUPAN003321000
- symbol: JSNZ_001062
- pan gene symbol?: —
- synonym:
- product: UPF0223 family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_001062
- symbol: JSNZ_001062
- product: UPF0223 family protein
- replicon: chromosome
- strand: +
- coordinates: 1067552..1067827
- length: 276
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGAATATGAGTATCCAATTGATTTAGACTGGAGTAATGAAGAGATGATTTCAGTGATA
AATTTCTTTAATCATGTAGAGAAGTATTATGAATCCGGCGTGACGGCAGGCGACTTTATG
GATGCATATAAAAGATTTAAAGAAATTGTGCCTGCTAAAGCAGAGGAAAAACAAATTTTT
AATACTTTCGAAAAAAGTAGTGGCTATAATAGTTACAAAGCAGTTCAAGATGTAAAAACT
CACTCTGAAGAACAAAGAGTAACAGCTAAAAAATAA60
120
180
240
276
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_001062
- symbol: JSNZ_001062
- description: UPF0223 family protein
- length: 91
- theoretical pI: 4.72285
- theoretical MW: 10749.9
- GRAVY: -0.831868
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds V-type ATPase, A subunit (TIGR01042; EC 3.6.3.14; HMM-score: 11.9)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined UPF0223; Uncharacterised protein family (UPF0223) (PF05256; HMM-score: 125)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6971
- Cytoplasmic Membrane Score: 0.0465
- Cell wall & surface Score: 0.0005
- Extracellular Score: 0.256
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003681
- TAT(Tat/SPI): 0.000538
- LIPO(Sec/SPII): 0.000503
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MEYEYPIDLDWSNEEMISVINFFNHVEKYYESGVTAGDFMDAYKRFKEIVPAKAEEKQIFNTFEKSSGYNSYKAVQDVKTHSEEQRVTAKK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.