From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_000942
  • pan locus tag?: SAUPAN003126000
  • symbol: JSNZ_000942
  • pan gene symbol?: —
  • synonym:
  • product: YjzD family protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_000942
  • symbol: JSNZ_000942
  • product: YjzD family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 946392..946577
  • length: 186
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAAACACCTCGTAACATTCTTTTGGGCATTATTATTAATGCAAATGATTAACTTTGTA
    CTTAATAGCCTAGTAGGTGGAGACAGCTTAAATGTAGTGAATCCAATTATCATGGCAGTA
    TTGTTCACGATTTTCACAGCAATTTTTGCTGCAGTAATTAAACCGCCGAAAGATTCATCA
    CAATAA
    60
    120
    180
    186

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: JSNZ_000942
  • symbol: JSNZ_000942
  • description: YjzD family protein
  • length: 61
  • theoretical pI: 9.44367
  • theoretical MW: 6767.17
  • GRAVY: 1.07377

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    no clan defined DUF2929; Protein of unknown function (DUF2929) (PF11151; HMM-score: 67.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9994
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0006
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.165867
    • TAT(Tat/SPI): 0.001076
    • LIPO(Sec/SPII): 0.109104
  • predicted transmembrane helices (TMHMM): 2

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

⊟Protein sequence[edit | edit source]

  • MKHLVTFFWALLLMQMINFVLNSLVGGDSLNVVNPIIMAVLFTIFTAIFAAVIKPPKDSSQ

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You can add further information about the gene and protein here.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=JSNZ_000942&oldid=106583"