From AureoWiki
Jump to navigation Jump to search

FunGene: 08-OCT-2024

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: JSNZ_000700
  • pan locus tag?: SAUPAN002629000
  • symbol: nrdI
  • pan gene symbol?: nrdI
  • synonym:
  • product: class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: JSNZ_000700
  • symbol: nrdI
  • product: class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI
  • replicon: chromosome
  • strand: +
  • coordinates: 735402..735800
  • length: 399
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq:
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAATAATATATTTTTCATTTACTGGAAATGTCCGTCGTTTTATTAAGAGAACAGAA
    CTTGAAAATACGCTTGAGATTACAGCAGAAAATTGTATGGAACCAGTTCATGAACCGTTT
    ATTATCGTTACTGGCACTATTGGATTTGGAGAAGTACCAGAACCCGTTCAATCTTTTTTA
    GAAGTTAATCATCAATACATCAGAGGTGTGGCAGCTAGCGGTAATCGAAATTGGGGACTA
    AATTTCGCAAAAGCGGGTCGCACGATATCAGAAGAGTATAATGTCCCTTTATTAATGAAG
    TTTGAGTTACATGGAAAAAACAAAGACGTTATTGAATTTAAGAACAAGGTGGGTAATTTT
    AATGAAAACCATGGAAGAGAAAAAGTACAATCATATTGA
    60
    120
    180
    240
    300
    360
    399

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: JSNZ_000700
  • symbol: NrdI
  • description: class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI
  • length: 132
  • theoretical pI: 7.67183
  • theoretical MW: 15166.2
  • GRAVY: -0.422727

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism nrdI protein (TIGR00333; HMM-score: 115.3)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    Flavoprotein (CL0042) Flavodoxin_NdrI; NrdI Flavodoxin like (PF07972; HMM-score: 126.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9903
    • Cytoplasmic Membrane Score: 0.005
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0046
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005252
    • TAT(Tat/SPI): 0.000118
    • LIPO(Sec/SPII): 0.001041
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq:
  • UniProt:

Protein sequence[edit | edit source]

  • MKIIYFSFTGNVRRFIKRTELENTLEITAENCMEPVHEPFIIVTGTIGFGEVPEPVQSFLEVNHQYIRGVAASGNRNWGLNFAKAGRTISEEYNVPLLMKFELHGKNKDVIEFKNKVGNFNENHGREKVQSY

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: NrdR (repression) regulon
    NrdR(TF)important in Deoxyribonucleotide biosynthesis;  regulation predicted or transferred from N315 and NCTC 8325  [2]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]