Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_000628
- pan locus tag?: SAUPAN002540000
- symbol: vraF
- pan gene symbol?: vraF
- synonym:
- product: ABC transporter ATP-binding protein VraF
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_000628
- symbol: vraF
- product: ABC transporter ATP-binding protein VraF
- replicon: chromosome
- strand: +
- coordinates: 662701..663462
- length: 762
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721GTGGCAATTTTAGAAGTAAAACAATTAACAAAAATATATGGAACTAAAAAAATGGCACAA
GAAGTGTTGCGAGATATCAATATGTCTATTGAAGAAGGCGAGTTTATTGCTATTATGGGT
CCCTCTGGATCTGGGAAAACGACATTATTAAATGTTTTAAGTTCAATTGATTATATTTCA
CAAGGTTCTATTACATTAAAAGGAAAAAAATTAGAAAAGCTTTCAAACAAGGAATTATCT
GATATACGCAAGCATGATATTGGTTTTATTTTTCAAGAGTATAATTTACTGCATACATTG
ACTGTTAAAGAAAACATAATGTTACCACTAACGGTTCAGAAGTTAGATAAAGAACATATG
TTAAATCGTTATGAAAAAGTAGCAGAAGCATTAAATATATTGGATATTAGTGATAAATAC
CCTTCTGAATTGTCTGGTGGACAAAGACAACGAACATCTGCTGCAAGAGCGTTTATTACA
TTACCTTCTATTATATTTGCTGACGAACCAACAGGTGCACTGGATTCTAAAAGTACTCAA
GATTTATTAAAACGATTAACAAGAATGAATGAAGCATTTAAGTCTACAATTATTATGGTA
ACGCATGATCCTGTTGCAGCAAGTTATGCCAATCGAGTAGTGATGCTAAAAGATGGTCAA
ATTTTCACTGAATTATACCAAGGGGATGACGATAAACATACCTTTTTCAAAGAAATAATA
CGTGTACAAAGTGTTTTAGGTGGCGTTAATTATGACCTTTAA60
120
180
240
300
360
420
480
540
600
660
720
762
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_000628
- symbol: VraF
- description: ABC transporter ATP-binding protein VraF
- length: 253
- theoretical pI: 7.0941
- theoretical MW: 28462.7
- GRAVY: -0.209881
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 215.8)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 207.8)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 207.8)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 202.5)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 185.8)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 179.7)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 179.4)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 176.4)and 82 moreTransport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 158.1)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 152.4)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 149.7)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 149.1)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 143.6)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 134.1)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 132.9)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 131.9)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 131.9)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 131.4)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 131.2)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 131)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 127.1)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 126.9)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 126.2)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 125.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 125.2)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 122)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 120.1)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 119.6)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 118)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 116.4)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 116)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 113.5)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 113.5)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 110.8)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 110.8)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 108.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 102.5)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 102.5)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 101.9)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 99.4)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 96.6)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 96.5)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 96.4)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 94.1)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 93.6)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 93.6)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 91.2)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 90.9)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 89.5)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 89.5)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 89.3)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 89.3)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 89.3)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 87)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 86.3)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 85.5)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 84.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 77.6)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 75.3)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 72.3)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 71.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 67.2)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 63.9)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 63.9)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 56.4)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 49.9)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 49.9)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 45.3)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 40)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 38.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 37.1)Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 17.8)Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 17.5)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions dTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 14.8)Protein synthesis tRNA and rRNA base modification tRNA 2-selenouridine synthase (TIGR03167; EC 2.9.1.-; HMM-score: 14.5)DNA metabolism DNA replication, recombination, and repair DnaA regulatory inactivator Hda (TIGR03420; HMM-score: 14.3)type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 14.2)Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 14.2)DNA metabolism DNA replication, recombination, and repair exonuclease SbcC (TIGR00618; HMM-score: 13.7)P-type DNA transfer ATPase VirB11 (TIGR02788; HMM-score: 13.5)Cellular processes Pathogenesis type II secretion system protein E (TIGR02533; HMM-score: 13.2)Protein fate Protein and peptide secretion and trafficking type II secretion system protein E (TIGR02533; HMM-score: 13.2)Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 13.1)helicase/secretion neighborhood ATPase (TIGR03819; HMM-score: 13.1)Cell envelope Surface structures twitching motility protein (TIGR01420; HMM-score: 12.9)Cellular processes Chemotaxis and motility twitching motility protein (TIGR01420; HMM-score: 12.9)DNA metabolism DNA replication, recombination, and repair Holliday junction DNA helicase RuvB (TIGR00635; EC 3.6.4.12; HMM-score: 12.5)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions guanylate kinase (TIGR03263; EC 2.7.4.8; HMM-score: 12.3)Cellular processes Conjugation P-type conjugative transfer ATPase TrbB (TIGR02782; HMM-score: 11.8)DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 11.4)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 114.7)and 32 moreSMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 35.4)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 30.6)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 23.1)AAA_25; AAA domain (PF13481; HMM-score: 19.6)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 19.2)nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 19.2)AAA_16; AAA ATPase domain (PF13191; HMM-score: 19)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 18.8)Rad17; Rad17 P-loop domain (PF03215; HMM-score: 18.2)AAA_22; AAA domain (PF13401; HMM-score: 18.1)AAA_18; AAA domain (PF13238; HMM-score: 17.8)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 17.6)AAA_23; AAA domain (PF13476; HMM-score: 16.5)AAA_28; AAA domain (PF13521; HMM-score: 16.4)nSTAND1; Novel STAND NTPase 1 (PF20703; HMM-score: 16.3)NB-ARC; NB-ARC domain (PF00931; HMM-score: 15.9)NACHT; NACHT domain (PF05729; HMM-score: 15.6)VapE-like_dom; Virulence-associated protein E-like domain (PF05272; HMM-score: 14.1)AAA_14; AAA domain (PF13173; HMM-score: 13.9)T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 13.8)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13.7)DO-GTPase2; Double-GTPase 2 (PF19993; HMM-score: 13.7)cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 13.5)AAA_30; AAA domain (PF13604; HMM-score: 13.5)TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 13.3)PhoH; PhoH-like protein (PF02562; HMM-score: 13.2)Adeno_IVa2; Adenovirus IVa2 protein (PF02456; HMM-score: 12.9)PRK; Phosphoribulokinase / Uridine kinase family (PF00485; HMM-score: 12.4)ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 12.2)AAA_24; AAA domain (PF13479; HMM-score: 12.2)RNA_helicase; RNA helicase (PF00910; HMM-score: 12)AAA_11; AAA domain (PF13086; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.06
- Cytoplasmic Membrane Score: 0.9331
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0066
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003923
- TAT(Tat/SPI): 0.00028
- LIPO(Sec/SPII): 0.000354
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MAILEVKQLTKIYGTKKMAQEVLRDINMSIEEGEFIAIMGPSGSGKTTLLNVLSSIDYISQGSITLKGKKLEKLSNKELSDIRKHDIGFIFQEYNLLHTLTVKENIMLPLTVQKLDKEHMLNRYEKVAEALNILDISDKYPSELSGGQRQRTSAARAFITLPSIIFADEPTGALDSKSTQDLLKRLTRMNEAFKSTIIMVTHDPVAASYANRVVMLKDGQIFTELYQGDDDKHTFFKEIIRVQSVLGGVNYDL
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p) - ↑ Mélanie Falord, Ulrike Mäder, Aurélia Hiron, Michel Débarbouillé, Tarek Msadek
Investigation of the Staphylococcus aureus GraSR regulon reveals novel links to virulence, stress response and cell wall signal transduction pathways.
PLoS One: 2011, 6(7);e21323
[PubMed:21765893] [WorldCat.org] [DOI] (I p)