Jump to navigation
Jump to search
FunGene: 08-OCT-2024
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: JSNZ_000618
- pan locus tag?: SAUPAN002529000
- symbol: dhaL
- pan gene symbol?: dhaL
- synonym:
- product: dihydroxyacetone kinase subunit DhaL
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: JSNZ_000618
- symbol: dhaL
- product: dihydroxyacetone kinase subunit DhaL
- replicon: chromosome
- strand: +
- coordinates: 654056..654640
- length: 585
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq:
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGAAAGTGAATGATATGAAAGCACGTTTATTAAATTTAGAAGAAACGTTTAAAAAACAT
GAATCTGAATTAACTGAATTAGATCGAGCAATTGGTGATGGTGACCACGGGGTTAACATG
GTTCGTGGGTTTAGTAGTCTTAAAGACAAACTTGATGATAGCTCAATGCAATCATTGTTC
AAATCGACTGGTATGGCATTGATGTCAAATGTTGGGGGTGCATCAGGACCACTGTATGGC
TTTAGCTTTGTTAAAATGTCTGCAGTCACCAAAGATGATATGGATAATCAAGATTTCATT
ACACTAATTCAGGCATTTGCCGAAGCGGTTGAATCACGTGGTAAAGTTACTTTAAATGAA
AAGACAATGTATGATGTAGTAGCGCGAGCAGCAGAGAAGCTTGAAAATGGTGAAACTTTA
ACATTCAATGATTTACAGCAATTAGCAGATAATACAAAAGATATGGTAGCAACGAAAGGT
AGAGCTGCATATTTTGGAGAAGAATCAAAAGGTTATATTGATCCAGGTGCTCAAAGTATG
GTTTATATTTTAAACGCTTTGATTGGAGATGAAGATAATGCCTAA60
120
180
240
300
360
420
480
540
585
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: JSNZ_000618
- symbol: DhaL
- description: dihydroxyacetone kinase subunit DhaL
- length: 194
- theoretical pI: 4.40795
- theoretical MW: 21261.8
- GRAVY: -0.381959
⊟Function[edit | edit source]
- reaction: EC 2.7.1.121? ExPASyPhosphoenolpyruvate--glycerone phosphotransferase Phosphoenolpyruvate + glycerone = pyruvate + glycerone phosphate
- TIGRFAM: dihydroxyacetone kinase, L subunit (TIGR02365; EC 2.7.-.-; HMM-score: 239.9)and 2 moredihydroxyacetone kinase (TIGR02361; EC 2.7.1.29; HMM-score: 79.3)Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS7 (TIGR01029; HMM-score: 13.2)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined Dak2; DAK2 domain (PF02734; HMM-score: 153.5)and 1 moreATPgrasp_N; ATP-grasp N-terminal domain (PF18130; HMM-score: 14.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9747
- Cytoplasmic Membrane Score: 0.0075
- Cell wall & surface Score: 0.0006
- Extracellular Score: 0.0172
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.015718
- TAT(Tat/SPI): 0.000729
- LIPO(Sec/SPII): 0.000894
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq:
- UniProt:
⊟Protein sequence[edit | edit source]
- MKVNDMKARLLNLEETFKKHESELTELDRAIGDGDHGVNMVRGFSSLKDKLDDSSMQSLFKSTGMALMSNVGGASGPLYGFSFVKMSAVTKDDMDNQDFITLIQAFAEAVESRGKVTLNEKTMYDVVARAAEKLENGETLTFNDLQQLADNTKDMVATKGRAAYFGEESKGYIDPGAQSMVYILNALIGDEDNA
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: CcpA regulon
CcpA (TF) important in Carbon catabolism; regulation predicted or transferred from N315 and NCTC 8325 in Wolfgramm et al. (https://doi.org/10.1101/2025.09.03.674026)
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)