From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS11165 [old locus tag: EGJ38_002237 ]
  • pan locus tag?: SAUPAN005731000
  • symbol: moaD
  • pan gene symbol?: moaD
  • synonym:
  • product: molybdopterin converting factor subunit 1

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS11165 [old locus tag: EGJ38_002237 ]
  • symbol: moaD
  • product: molybdopterin converting factor subunit 1
  • replicon: chromosome
  • strand: -
  • coordinates: 2237421..2237654
  • length: 234
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (2237421..2237654) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAAGGTACTTTACTTCGCAGAAATTAAAGATATATTACAAAAAGCACAGGAAGATATT
    GTGCTTGAACAAGCATTGACTGTACAACAATTTGAAGATTTATTGTTTGAACGTTATCCG
    CAAATCAATAATAAAAAGTTTCAAGTTGCTGTAAATGAGGAATTTGTACAAAAATCAGAT
    TTCATTCAACCTAATGATACTGTTGCATTAATTCCACCGGTTAGTGGAGGTTAA
    60
    120
    180
    234

Protein[edit | edit source]

Protein Data Bank: 2Q5W
Protein Data Bank: 2QIE

General[edit | edit source]

  • locus tag: EGJ38_RS11165 [old locus tag: EGJ38_002237 ]
  • symbol: MoaD
  • description: molybdopterin converting factor subunit 1
  • length: 77
  • theoretical pI: 4.19545
  • theoretical MW: 8871.09
  • GRAVY: -0.172727

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin converting factor, subunit 1 (TIGR01682; HMM-score: 76.7)
    and 2 more
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin MoaD family protein (TIGR01687; HMM-score: 40.8)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Thiamine thiamine biosynthesis protein ThiS (TIGR01683; HMM-score: 16.2)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    Ubiquitin (CL0072) ThiS; ThiS family (PF02597; HMM-score: 67.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9917
    • Cytoplasmic Membrane Score: 0.0073
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.001
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00173
    • TAT(Tat/SPI): 0.00019
    • LIPO(Sec/SPII): 0.000286
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000866971 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKVLYFAEIKDILQKAQEDIVLEQALTVQQFEDLLFERYPQINNKKFQVAVNEEFVQKSDFIQPNDTVALIPPVSGG

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]