Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS10785 [old locus tag: EGJ38_002161 ]
- pan locus tag?: SAUPAN005587000
- symbol: EGJ38_RS10785
- pan gene symbol?: lacF
- synonym:
- product: PTS lactose/cellobiose transporter subunit IIA
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS10785 [old locus tag: EGJ38_002161 ]
- symbol: EGJ38_RS10785
- product: PTS lactose/cellobiose transporter subunit IIA
- replicon: chromosome
- strand: -
- coordinates: 2180593..2180904
- length: 312
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (2180593..2180904) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAATAGAGAAGAAGTCCAATTATTAGGTTTTGAAATTGTTGCATTTGCAGGGGATGCA
CGTTCTAAGTTTTTAGAAGCATTGACAGCAGCTCAAGCTGGAGATTTTGCAAAAGCAGAT
GCATTGATTGAAGAAGGAAACAATTGCATTGCTGAAGCGCATAGAGCACAAACAAGCCTG
TTAGCTAAAGAAGCGCAAGGTGATGATATTGCATACAGTGTAACGATGATGCATGGTCAA
GACCATTTAATGACAACAATTTTACTGAAAGATTTAATGAAGCATTTATTAGAATTTTAT
AAAAGAGGGTGA60
120
180
240
300
312
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS10785 [old locus tag: EGJ38_002161 ]
- symbol: EGJ38_RS10785
- description: PTS lactose/cellobiose transporter subunit IIA
- length: 103
- theoretical pI: 4.85685
- theoretical MW: 11369.9
- GRAVY: -0.0990291
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Carbohydrates, organic alcohols, and acids PTS system, lactose-specific IIa component (TIGR00823; EC 2.7.1.69; HMM-score: 157.8)and 1 moreantimicrobial peptide, SdpC family (TIGR04032; HMM-score: 13.1)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: no clan defined PTS_IIA; PTS system, Lactose/Cellobiose specific IIA subunit (PF02255; HMM-score: 112.5)and 1 moreDUF1771; Domain of unknown function (DUF1771) (PF08590; HMM-score: 12.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9957
- Cytoplasmic Membrane Score: 0.0006
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0036
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.047697
- TAT(Tat/SPI): 0.120458
- LIPO(Sec/SPII): 0.004871
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001078309 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNREEVQLLGFEIVAFAGDARSKFLEALTAAQAGDFAKADALIEEGNNCIAEAHRAQTSLLAKEAQGDDIAYSVTMMHGQDHLMTTILLKDLMKHLLEFYKRG
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: LacR see EGJ38_002161
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]