From AureoWiki
Jump to navigation Jump to search

NCBI: 22-FEB-2026

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_RS04540 [old locus tag: EGJ38_000909 ]
  • pan locus tag?: SAUPAN003047000
  • symbol: mnhG1
  • pan gene symbol?: mnhG1
  • synonym:
  • product: Na+/H+ antiporter Mnh1 subunit G

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_RS04540 [old locus tag: EGJ38_000909 ]
  • symbol: mnhG1
  • product: Na+/H+ antiporter Mnh1 subunit G
  • replicon: chromosome
  • strand: -
  • coordinates: 906239..906595
  • length: 357
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NZ_CM129921 (906239..906595) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGATCAAAATCATACTGATTAGTCTTGCACTTATCTTTGTTATCATCGGTGCTTTAATT
    AGCGCCCTAGCAGCTATAGGATTATTGAGACTTGAAGATGTATATTCACGTGCACATGCT
    GCCGGAAAAGCATCAACATTAGGTGCAATGTCATTACTATTTGGTACGTTTTTATATTTT
    ATTGCTACTCAAGGTTTTGTAAATATGCAATTAATCGTTGCGATTATCTTTGTATTAATT
    ACAGGTCCTCTTTCAAGTCATATGATTATGAAAGCAGCATATAATATTAAAACGCCTTAT
    ACTAAAAAGACTAAAGTCGATGAAATTTCGGAAGACTTAAAAGACACAAAATTGTAG
    60
    120
    180
    240
    300
    357

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_RS04540 [old locus tag: EGJ38_000909 ]
  • symbol: MnhG1
  • description: Na+/H+ antiporter Mnh1 subunit G
  • length: 118
  • theoretical pI: 10.0063
  • theoretical MW: 12818.4
  • GRAVY: 0.894915

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds monovalent cation/proton antiporter, MnhG/PhaG subunit (TIGR01300; HMM-score: 87.9)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined PhaG_MnhG_YufB; Na+/H+ antiporter subunit (PF03334; HMM-score: 85.7)
    and 3 more
    CopD_like (CL0430) YtpI; YtpI-like protein (PF14007; HMM-score: 8.4)
    TSPAN_4TM-like (CL0347) Tetraspanin; Tetraspanin family (PF00335; HMM-score: 8.1)
    no clan defined DUF6057; Family of unknown function (DUF6057) (PF19529; HMM-score: 7.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9983
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0017
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.04049
    • TAT(Tat/SPI): 0.001137
    • LIPO(Sec/SPII): 0.042421
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_000590451 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYFIATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]