Jump to navigation
Jump to search
NCBI: 22-FEB-2026
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_RS03135 [old locus tag: EGJ38_000628 ]
- pan locus tag?: SAUPAN002540000
- symbol: vraF
- pan gene symbol?: vraF
- synonym:
- product: ABC transporter ATP-binding protein VraF
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_RS03135 [old locus tag: EGJ38_000628 ]
- symbol: vraF
- product: ABC transporter ATP-binding protein VraF
- replicon: chromosome
- strand: +
- coordinates: 662701..663462
- length: 762
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CM129921 (662701..663462) NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721GTGGCAATTTTAGAAGTAAAACAATTAACAAAAATATATGGAACTAAAAAAATGGCACAA
GAAGTGTTGCGAGATATCAATATGTCTATTGAAGAAGGCGAGTTTATTGCTATTATGGGT
CCCTCTGGATCTGGGAAAACGACATTATTAAATGTTTTAAGTTCAATTGATTATATTTCA
CAAGGTTCTATTACATTAAAAGGAAAAAAATTAGAAAAGCTTTCAAACAAGGAATTATCT
GATATACGCAAGCATGATATTGGTTTTATTTTTCAAGAGTATAATTTACTGCATACATTG
ACTGTTAAAGAAAACATAATGTTACCACTAACGGTTCAGAAGTTAGATAAAGAACATATG
TTAAATCGTTATGAAAAAGTAGCAGAAGCATTAAATATATTGGATATTAGTGATAAATAC
CCTTCTGAATTGTCTGGTGGACAAAGACAACGAACATCTGCTGCAAGAGCGTTTATTACA
TTACCTTCTATTATATTTGCTGACGAACCAACAGGTGCACTGGATTCTAAAAGTACTCAA
GATTTATTAAAACGATTAACAAGAATGAATGAAGCATTTAAGTCTACAATTATTATGGTA
ACGCATGATCCTGTTGCAGCAAGTTATGCCAATCGAGTAGTGATGCTAAAAGATGGTCAA
ATTTTCACTGAATTATACCAAGGGGATGACGATAAACATACCTTTTTCAAAGAAATAATA
CGTGTACAAAGTGTTTTAGGTGGCGTTAATTATGACCTTTAA60
120
180
240
300
360
420
480
540
600
660
720
762
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_RS03135 [old locus tag: EGJ38_000628 ]
- symbol: VraF
- description: ABC transporter ATP-binding protein VraF
- length: 253
- theoretical pI: 7.0941
- theoretical MW: 28462.7
- GRAVY: -0.209881
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 215.8)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 207.8)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 207.8)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 202.5)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 185.8)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 179.7)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 179.4)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 176.4)and 82 moreTransport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 158.1)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 152.4)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 149.7)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 149.1)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 143.6)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 134.1)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 132.9)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 131.9)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 131.9)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 131.4)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 131.2)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 131)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 127.1)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 126.9)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 126.2)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 125.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 125.2)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 122)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 120.1)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 119.6)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 118)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 116.4)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 116)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 113.5)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 113.5)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 110.8)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 110.8)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 108.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 102.5)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 102.5)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 101.9)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 99.4)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 96.6)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 96.5)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 96.4)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 94.1)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 93.6)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 93.6)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 91.2)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 90.9)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 89.5)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 89.5)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 89.3)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 89.3)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 89.3)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 87)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 86.3)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 85.5)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 84.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 77.6)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 75.3)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 72.3)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 71.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 67.2)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 63.9)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 63.9)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 56.4)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 49.9)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 49.9)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 45.3)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 40)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 38.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 37.1)Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 17.8)Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 17.5)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions dTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 14.8)Protein synthesis tRNA and rRNA base modification tRNA 2-selenouridine synthase (TIGR03167; EC 2.9.1.-; HMM-score: 14.5)DNA metabolism DNA replication, recombination, and repair DnaA regulatory inactivator Hda (TIGR03420; HMM-score: 14.3)type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 14.2)Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 14.2)DNA metabolism DNA replication, recombination, and repair exonuclease SbcC (TIGR00618; HMM-score: 13.7)P-type DNA transfer ATPase VirB11 (TIGR02788; HMM-score: 13.5)Cellular processes Pathogenesis type II secretion system protein E (TIGR02533; HMM-score: 13.2)Protein fate Protein and peptide secretion and trafficking type II secretion system protein E (TIGR02533; HMM-score: 13.2)Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 13.1)helicase/secretion neighborhood ATPase (TIGR03819; HMM-score: 13.1)Cell envelope Surface structures twitching motility protein (TIGR01420; HMM-score: 12.9)Cellular processes Chemotaxis and motility twitching motility protein (TIGR01420; HMM-score: 12.9)DNA metabolism DNA replication, recombination, and repair Holliday junction DNA helicase RuvB (TIGR00635; EC 3.6.4.12; HMM-score: 12.5)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions guanylate kinase (TIGR03263; EC 2.7.4.8; HMM-score: 12.3)Cellular processes Conjugation P-type conjugative transfer ATPase TrbB (TIGR02782; HMM-score: 11.8)DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 11.4)
- TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 114.7)and 32 moreSMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 35.4)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 30.6)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 23.1)AAA_25; AAA domain (PF13481; HMM-score: 19.6)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 19.2)nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 19.2)AAA_16; AAA ATPase domain (PF13191; HMM-score: 19)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 18.8)Rad17; Rad17 P-loop domain (PF03215; HMM-score: 18.2)AAA_22; AAA domain (PF13401; HMM-score: 18.1)AAA_18; AAA domain (PF13238; HMM-score: 17.8)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 17.6)AAA_23; AAA domain (PF13476; HMM-score: 16.5)AAA_28; AAA domain (PF13521; HMM-score: 16.4)nSTAND1; Novel STAND NTPase 1 (PF20703; HMM-score: 16.3)NB-ARC; NB-ARC domain (PF00931; HMM-score: 15.9)NACHT; NACHT domain (PF05729; HMM-score: 15.6)VapE-like_dom; Virulence-associated protein E-like domain (PF05272; HMM-score: 14.1)AAA_14; AAA domain (PF13173; HMM-score: 13.9)T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 13.8)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13.7)DO-GTPase2; Double-GTPase 2 (PF19993; HMM-score: 13.7)cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 13.5)AAA_30; AAA domain (PF13604; HMM-score: 13.5)TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 13.3)PhoH; PhoH-like protein (PF02562; HMM-score: 13.2)Adeno_IVa2; Adenovirus IVa2 protein (PF02456; HMM-score: 12.9)PRK; Phosphoribulokinase / Uridine kinase family (PF00485; HMM-score: 12.4)ATP-synt_ab; ATP synthase alpha/beta family, nucleotide-binding domain (PF00006; HMM-score: 12.2)AAA_24; AAA domain (PF13479; HMM-score: 12.2)RNA_helicase; RNA helicase (PF00910; HMM-score: 12)AAA_11; AAA domain (PF13086; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.06
- Cytoplasmic Membrane Score: 0.9331
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0066
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003923
- TAT(Tat/SPI): 0.00028
- LIPO(Sec/SPII): 0.000354
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000985996 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MAILEVKQLTKIYGTKKMAQEVLRDINMSIEEGEFIAIMGPSGSGKTTLLNVLSSIDYISQGSITLKGKKLEKLSNKELSDIRKHDIGFIFQEYNLLHTLTVKENIMLPLTVQKLDKEHMLNRYEKVAEALNILDISDKYPSELSGGQRQRTSAARAFITLPSIIFADEPTGALDSKSTQDLLKRLTRMNEAFKSTIIMVTHDPVAASYANRVVMLKDGQIFTELYQGDDDKHTFFKEIIRVQSVLGGVNYDL
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: GraR see EGJ38_000628
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]