Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_002096 [new locus tag: EGJ38_RS10465 ]
- pan locus tag?: SAUPAN005431000
- symbol: EGJ38_002096
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_002096
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_002096 [new locus tag: EGJ38_RS10465 ]
- symbol: EGJ38_002096
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2108481..2108831
- length: 351
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423997 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301TTGAACATACTAAGATATTTATTAGGAATAGGTTTTAGTGTAATAGGTGTATTGCATTTT
ACACGAGAACGACAATTTAGAAATATCATACCGAAATGTTTGCCACTTCGAAAAACAGCG
GTTCTTGTTACAGGAATCTTTGAGATATTATTTGGACTTGCACTTTTAATTAAAAGACCA
TCTCAATGCTTGAAAAATACAATCAATCTATTCTTGCTAGCTGTATTCCCAGCTAATATC
TATATGGCAGTTAAAAAGTTACCTTTAGGAGATAAACAATTGCCAACATGGCAACTATAT
TTAAGGTTACCTATGCAGTTCGTGTTAATGGGACTTATTAAGAAATTATAG60
120
180
240
300
351
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_002096 [new locus tag: EGJ38_RS10465 ]
- symbol: EGJ38_002096
- description: hypothetical protein
- length: 116
- theoretical pI: 11.2863
- theoretical MW: 13339.4
- GRAVY: 0.64569
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325, Newman
- PFAM: DoxD-like (CL0131) MauE; Methylamine utilisation protein MauE (PF07291; HMM-score: 18.4)DoxX_3; DoxX-like family (PF13781; HMM-score: 16.6)TSPAN_4TM-like (CL0347) Tetraspanin; Tetraspanin family (PF00335; HMM-score: 16.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.003
- Cytoplasmic Membrane Score: 0.9778
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.0189
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010688
- TAT(Tat/SPI): 0.000833
- LIPO(Sec/SPII): 0.007345
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423997 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNILRYLLGIGFSVIGVLHFTRERQFRNIIPKCLPLRKTAVLVTGIFEILFGLALLIKRPSQCLKNTINLFLLAVFPANIYMAVKKLPLGDKQLPTWQLYLRLPMQFVLMGLIKKL
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_002096 < pdp < deoC2
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)