From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_002084 [new locus tag: EGJ38_RS10405 ]
  • pan locus tag?: SAUPAN005415000
  • symbol: qsrR
  • pan gene symbol?: qsrR
  • synonym:
  • product: winged helix-turn-helix transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_002084 [new locus tag: EGJ38_RS10405 ]
  • symbol: qsrR
  • product: winged helix-turn-helix transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2095435..2095770
  • length: 336
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2423985 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGAAGTATGTCCGTATCTCGAAGAAACTTTTAAAATAATTGGTAGAAGTTGGAATGGA
    TTAATCATTAATTATCTCTCAAGATGTAATGACTGTTCAGCACACTTTTCCGATATGAAA
    AGAGATTTGAAAACAATAACACCACGTGCTTTAAGTCTTAAGTTGTCAGAGCTTGCACAA
    TGGGAGTTAGTTGAGAAGCAAATCATTTCTACGAGTCCAGTACAAATTATTTATGTGCTA
    ACTGAAAAAGGTAAAGCGTTAGCAGAGGCTTTACATCCAATTGAAGCATGGGCGCAATCA
    TATGTCGATTTAACAGATCAACGTACTGCTAAATAA
    60
    120
    180
    240
    300
    336

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_002084 [new locus tag: EGJ38_RS10405 ]
  • symbol: QsrR
  • description: winged helix-turn-helix transcriptional regulator
  • length: 111
  • theoretical pI: 6.50773
  • theoretical MW: 12685.6
  • GRAVY: -0.145946

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    HTH (CL0123) HxlR; HxlR-like helix-turn-helix (PF01638; HMM-score: 62.5)
    and 4 more
    Replic_Relax; Replication-relaxation (PF13814; HMM-score: 13.5)
    HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 13.4)
    HTH_45; Winged helix-turn-helix (PF14947; HMM-score: 13.3)
    no clan defined TackOD1; Thaumarchaeal output domain 1 (PF18551; HMM-score: 11.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9903
    • Cytoplasmic Membrane Score: 0.0011
    • Cell wall & surface Score: 0.0005
    • Extracellular Score: 0.0081
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.013279
    • TAT(Tat/SPI): 0.000632
    • LIPO(Sec/SPII): 0.026222
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2423985 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MEVCPYLEETFKIIGRSWNGLIINYLSRCNDCSAHFSDMKRDLKTITPRALSLKLSELAQWELVEKQIISTSPVQIIYVLTEKGKALAEALHPIEAWAQSYVDLTDQRTAK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]