Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001943 [new locus tag: EGJ38_RS09700 ]
- pan locus tag?: SAUPAN004943000
- symbol: EGJ38_001943
- pan gene symbol?: —
- synonym:
- product: NETI motif-containing protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001943 [new locus tag: EGJ38_RS09700 ]
- symbol: EGJ38_001943
- product: NETI motif-containing protein
- replicon: chromosome
- strand: -
- coordinates: 1959676..1959849
- length: 174
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423852 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAAATTCAAAGTAAATGAGAATGAAACAATTGCTGATTGTTTGTCACGAATGAAAATG
CAAGGGTATATGCCGGTAAAACGTCTTGAAAAACCCGTGTTTCAGGAGCAAAAAGATGGC
ACGGTTGAAGTATCACATCAAGAAATCATTTTTGTAGGTAAGAAAATCCAATAA60
120
174
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001943 [new locus tag: EGJ38_RS09700 ]
- symbol: EGJ38_001943
- description: NETI motif-containing protein
- length: 57
- theoretical pI: 9.24387
- theoretical MW: 6685.83
- GRAVY: -0.587719
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, NCTC8325, USA300_FPR3757
- PFAM: no clan defined NETI; NETI protein (PF14044; HMM-score: 90.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9868
- Cytoplasmic Membrane Score: 0.0086
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0044
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.016017
- TAT(Tat/SPI): 0.000997
- LIPO(Sec/SPII): 0.003885
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423852 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKFKVNENETIADCLSRMKMQGYMPVKRLEKPVFQEQKDGTVEVSHQEIIFVGKKIQ
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_001943 < EGJ38_001944
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)