Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_001416 [new locus tag: EGJ38_RS07070 ]
- pan locus tag?: SAUPAN003863000
- symbol: EGJ38_001416
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_001416
- product: zinc-finger domain-containing protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_001416 [new locus tag: EGJ38_RS07070 ]
- symbol: EGJ38_001416
- product: zinc-finger domain-containing protein
- replicon: chromosome
- strand: -
- coordinates: 1428800..1428994
- length: 195
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2423378 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181GTGTCGCTTATTTTAACTTTTTCAGAGCAAAATGCACTCGCGAAAATAGATGATTTAATG
AATACTTATTGCAATCAATGTCCAATCAAAACTCGTCTGCGTAAATTAGAGGGGAAAACG
AAGGCGCATCATTTTTGTATCAATGAGTGTTCAATAGGGAAAGAAATAAAACAATTAGGA
AATGAACTTCAATAG60
120
180
195
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_001416 [new locus tag: EGJ38_RS07070 ]
- symbol: EGJ38_001416
- description: zinc-finger domain-containing protein
- length: 64
- theoretical pI: 8.33898
- theoretical MW: 7324.53
- GRAVY: -0.403125
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for COL, N315, NCTC8325
- PFAM: no clan defined zf-C2HCIx2C; Zinc-finger (PF10782; HMM-score: 98.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9888
- Cytoplasmic Membrane Score: 0.0034
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.0075
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.066858
- TAT(Tat/SPI): 0.000807
- LIPO(Sec/SPII): 0.006087
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2423378 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSLILTFSEQNALAKIDDLMNTYCNQCPIKTRLRKLEGKTKAHHFCINECSIGKEIKQLGNELQ
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : brxA < cvfC < EGJ38_001415 < EGJ38_001416
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)