From AureoWiki
Jump to navigation Jump to search

NCBI: 01-DEC-2025

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_000596 [new locus tag: EGJ38_RS02975 ]
  • pan locus tag?: SAUPAN002501000
  • symbol: mnhG2
  • pan gene symbol?: mnhG2
  • synonym:
  • alternate name: JSNZ_000596
  • product: Na+/H+ antiporter Mnh2 subunit G

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_000596 [new locus tag: EGJ38_RS02975 ]
  • symbol: mnhG2
  • product: Na+/H+ antiporter Mnh2 subunit G
  • replicon: chromosome
  • strand: +
  • coordinates: 629498..629935
  • length: 438
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2422574 NCBI
  • BioCyc:
  • MicrobesOnline:

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGAAATAACAAAAGAAATCTTTAGTCTTATTGCTGCTGTGATGTTGTTGTTAGGTAGT
    TTTATTGCTCTTATTAGTGCAATAGGTATCGTGAAATTCCAAGATGTTTTCTTAAGAAGT
    CACGCTGCGACAAAAAGTTCAACTTTATCCGTGTTATTAACTTTAATCGGTGTATTAATT
    TATTTTATTGTGAATACAGGATTTTTCAGTGTGCGTTTATTACTGTCACTTGTTTTTATT
    AATTTAACTTCTCCAGTCGGCATGCACTTAGTCGCTCGCGCTGCTTATCGCAACGGCGCT
    TATATGTATCGAAAAAATGATGCTCACACACATGCATCAATATTATTAAGTTCAAATGAA
    CAAAACTCTACAGAAGCATTACAATTACGTGCTAAAAAACGAGAAGAGCATCGTAAGAAA
    TGGTATCAAAACGATTGA
    60
    120
    180
    240
    300
    360
    420
    438


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: EGJ38_000596 [new locus tag: EGJ38_RS02975 ]
  • symbol: MnhG2
  • description: Na+/H+ antiporter Mnh2 subunit G
  • length: 145
  • theoretical pI: 10.4527
  • theoretical MW: 16302
  • GRAVY: 0.342069

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds monovalent cation/proton antiporter, MnhG/PhaG subunit (TIGR01300; HMM-score: 90)
    and 1 more
    exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase (TIGR03025; HMM-score: 15.8)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    no clan defined PhaG_MnhG_YufB; Na+/H+ antiporter subunit (PF03334; HMM-score: 79)
    and 3 more
    DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 12.2)
    DUF7472; Family of unknown function (DUF7472) (PF24284; HMM-score: 8.3)
    TSPAN_4TM-like (CL0347) Tetraspanin; Tetraspanin family (PF00335; HMM-score: 6.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9996
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0004
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008271
    • TAT(Tat/SPI): 0.0003
    • LIPO(Sec/SPII): 0.021697
  • predicted transmembrane helices (TMHMM): 3

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2422574 NCBI
  • UniProt:

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MEITKEIFSLIAAVMLLLGSFIALISAIGIVKFQDVFLRSHAATKSSTLSVLLTLIGVLIYFIVNTGFFSVRLLLSLVFINLTSPVGMHLVARAAYRNGAYMYRKNDAHTHASILLSSNEQNSTEALQLRAKKREEHRKKWYQND

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: SigB (activation) regulon
    SigB(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [2] [3] [4]   other strains

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
    Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
    Bioinformatics: 2018, 34(23);4118-4120
    [PubMed:29931111] [WorldCat.org] [DOI] (I p)
  2. ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  3. ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)
  4. ↑ Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J Bacteriol: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]