Jump to navigation
Jump to search
m (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "") |
m (Text replacement - "gene Genbank" to "gene RefSeq") |
||
Line 1: | Line 1: | ||
__TOC__ | |||
<protect> | <protect> | ||
<aureodatabase> | <aureodatabase>annotation</aureodatabase> | ||
=Summary= | =Summary= | ||
* <aureodatabase>organism</aureodatabase> | *<aureodatabase>organism</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>pan locus</aureodatabase> | *<aureodatabase>pan locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>pan gene symbol</aureodatabase> | *<aureodatabase>pan gene symbol</aureodatabase> | ||
* <aureodatabase>gene synonyms</aureodatabase> | *<aureodatabase>gene synonyms</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
</protect> | </protect> | ||
Line 24: | Line 25: | ||
==General== | ==General== | ||
* <aureodatabase>gene type</aureodatabase> | *<aureodatabase>gene type</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
* <aureodatabase>gene replicon</aureodatabase> | *<aureodatabase>gene replicon</aureodatabase> | ||
* <aureodatabase>strand</aureodatabase> | *<aureodatabase>strand</aureodatabase> | ||
* <aureodatabase>gene coordinates</aureodatabase> | *<aureodatabase>gene coordinates</aureodatabase> | ||
* <aureodatabase>gene length</aureodatabase> | *<aureodatabase>gene length</aureodatabase> | ||
* <aureodatabase>essential</aureodatabase> | *<aureodatabase>essential</aureodatabase> | ||
*<aureodatabase>gene comment</aureodatabase> | |||
</protect> | </protect> | ||
Line 38: | Line 40: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>gene | *<aureodatabase>gene location</aureodatabase> | ||
* <aureodatabase>gene | *<aureodatabase>gene BioCyc</aureodatabase> | ||
*<aureodatabase>gene MicrobesOnline</aureodatabase> | |||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Phenotype== | ==Phenotype== | ||
</protect> | </protect> | ||
Share your knowledge and add information here. [<span class="plainlinks">[//aureowiki.med.uni-greifswald.de/index.php?title={{PAGENAMEE}}&veaction=edit§ion=6 edit]</span>] | |||
<protect> | <protect> | ||
==DNA sequence== | ==DNA sequence== | ||
* <aureodatabase>gene sequence</aureodatabase> | *<aureodatabase>gene sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
<aureodatabase>RNA regulated operons</aureodatabase> | |||
</protect> | |||
<protect> | |||
=Protein= | =Protein= | ||
<aureodatabase>protein 3D view</aureodatabase> | <aureodatabase>protein 3D view</aureodatabase> | ||
==General== | ==General== | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>protein symbol</aureodatabase> | *<aureodatabase>protein symbol</aureodatabase> | ||
* <aureodatabase>protein description</aureodatabase> | *<aureodatabase>protein description</aureodatabase> | ||
* <aureodatabase>protein length</aureodatabase> | *<aureodatabase>protein length</aureodatabase> | ||
* <aureodatabase>theoretical pI</aureodatabase> | *<aureodatabase>theoretical pI</aureodatabase> | ||
* <aureodatabase>theoretical MW</aureodatabase> | *<aureodatabase>theoretical MW</aureodatabase> | ||
* <aureodatabase>GRAVY</aureodatabase> | *<aureodatabase>GRAVY</aureodatabase> | ||
</protect> | </protect> | ||
Line 71: | Line 77: | ||
==Function== | ==Function== | ||
* <aureodatabase>protein reaction</aureodatabase> | *<aureodatabase>protein reaction</aureodatabase> | ||
* <aureodatabase>protein TIGRFAM</aureodatabase> | *<aureodatabase>protein TIGRFAM</aureodatabase> | ||
* <aureodatabase>protein TheSeed</aureodatabase> | *<aureodatabase>protein TheSeed</aureodatabase> | ||
* <aureodatabase>protein PFAM</aureodatabase> | *<aureodatabase>protein PFAM</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Structure, modifications & | ==Structure, modifications & cofactors== | ||
* <aureodatabase>protein domains</aureodatabase> | *<aureodatabase>protein domains</aureodatabase> | ||
* <aureodatabase>protein modifications</aureodatabase> | *<aureodatabase>protein modifications</aureodatabase> | ||
* <aureodatabase>protein cofactors</aureodatabase> | *<aureodatabase>protein cofactors</aureodatabase> | ||
* <aureodatabase>protein effectors</aureodatabase> | *<aureodatabase>protein effectors</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein regulated operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 90: | Line 96: | ||
==Localization== | ==Localization== | ||
* <aureodatabase>protein Psortb</aureodatabase> | *<aureodatabase>protein Psortb</aureodatabase> | ||
* <aureodatabase>protein LocateP</aureodatabase> | *<aureodatabase>protein LocateP</aureodatabase> | ||
* <aureodatabase>protein SignalP</aureodatabase> | *<aureodatabase>protein SignalP</aureodatabase> | ||
* <aureodatabase>protein TMHMM</aureodatabase> | *<aureodatabase>protein TMHMM</aureodatabase> | ||
</protect> | </protect> | ||
Line 99: | Line 105: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>protein GI</aureodatabase> | *<aureodatabase>protein GI</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein RefSeq</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein UniProt</aureodatabase> | ||
</protect> | </protect> | ||
Line 107: | Line 113: | ||
==Protein sequence== | ==Protein sequence== | ||
* <aureodatabase>protein sequence</aureodatabase> | *<aureodatabase>protein sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Experimental data== | ||
* <aureodatabase>protein validated peptides</aureodatabase> | *<aureodatabase>protein validated peptides</aureodatabase> | ||
*<aureodatabase>protein validated localization</aureodatabase> | |||
*<aureodatabase>protein validated quantitative data</aureodatabase> | |||
*<aureodatabase>protein partners</aureodatabase> | |||
</protect> | </protect> | ||
Line 124: | Line 133: | ||
==Operon== | ==Operon== | ||
* <aureodatabase>operons</aureodatabase> | *<aureodatabase>operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 130: | Line 139: | ||
==Regulation== | ==Regulation== | ||
*<aureodatabase>regulators</aureodatabase> | |||
* <aureodatabase>regulators</aureodatabase> | |||
</protect> | </protect> | ||
Line 137: | Line 145: | ||
==Transcription pattern== | ==Transcription pattern== | ||
* <aureodatabase>expression browser</aureodatabase> | *<aureodatabase>expression browser</aureodatabase> | ||
</protect> | </protect> | ||
Line 143: | Line 151: | ||
==Protein synthesis (provided by Aureolib)== | ==Protein synthesis (provided by Aureolib)== | ||
* <aureodatabase>protein synthesis Aureolib</aureodatabase> | *<aureodatabase>protein synthesis Aureolib</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Protein stability== | ||
* <aureodatabase>protein half-life</aureodatabase> | *<aureodatabase>protein half-life</aureodatabase> | ||
</protect> | </protect> | ||
Latest revision as of 12:55, 11 March 2016
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS06460 [old locus tag: SA1144 ]
- pan locus tag?: SAUPAN003618000
- symbol: SA_RS06460
- pan gene symbol?: miaA
- synonym:
- product: tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901ATGAATAAAAATAAGCCTTTTATTGTAGTAATTGTGGGGCCAACTGCTTCAGGTAAAACA
GAGCTTAGCATAGAACTCGCGAAGCGTATCAATGGTGAAATCATAAGCGGTGATTCTATG
CAAGTTTACAAACATATGAATATTGGAACTGCAAAAGTAACACCTGAAGAAATGGATGGT
ATTCCACATCATTTAATTGATATCTTGAATCCTGATGATACATTTTCAGCATATGAATTC
AAGCGATTAGCAGAAGATTTAATTACTGATATAACGAATAGAGGTAAAGTTCCAATCATA
GCAGGTGGAACAGGCTTATATATTCAATCATTAATATATAATTATGAATTAGAAGATGAA
ACAGTTACACCTGCACAATTATCCATAGTTAAACAAAAGTTATCTGCATTAGAACATTTA
GATAATCAGCAACTACACGATTATTTAGCTCAATTTGATGCGGTTTCTGCAGAAAATATT
CACCCTAACAACCGCCAAAGAGTGTTGCGCGCTATTGAATATTATTTAAAAACAAAAAAA
CTTTTGAGTAATCGCAAGAAAGTGCAACAATTTACTGAAAATTATGATACATTATTATTA
GGGATTGAAATGTCGCGTAAAACATTATATTCAAGAATAAATAAACGTGTTGATATTATG
TTGGATCACGGATTATTTAGAGAAGTGCAACAACTTGTTGAACAAGGCTATGAATCTTGC
CAAAGTATGCAAGCTATTGGATATAAAGAATTAATACCTGTGATTAACGGACAAATGATT
TATGAAGATGCTGTCAATGATTTAAAGCAACATTCACGCCAATATGCAAAACGACAAATG
ACATGGTTCAAGAATAAAATGAGTGTTCATTGGTTAGATAAAGAAAATATGTCACTTCAA
ATGATGTTAGATGAGATTACAACCCAGATTAAGTAA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
936
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS06460 [old locus tag: SA1144 ]
- symbol: SA_RS06460
- description: tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA
- length: 311
- theoretical pI: 6.80558
- theoretical MW: 35868
- GRAVY: -0.431833
⊟Function[edit | edit source]
- reaction: EC 2.5.1.75? ExPASytRNA dimethylallyltransferase Dimethylallyl diphosphate + adenine37 in tRNA = diphosphate + N6-dimethylallyladenine37 in tRNA
- TIGRFAM: Protein synthesis tRNA and rRNA base modification tRNA dimethylallyltransferase (TIGR00174; EC 2.5.1.75; HMM-score: 324.5)and 4 morecarbohydrate kinase, thermoresistant glucokinase family (TIGR01313; EC 2.7.1.-; HMM-score: 15.3)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions cytidylate kinase (TIGR00017; EC 2.7.4.14; HMM-score: 13.4)putative cytidylate kinase (TIGR02173; EC 2.7.4.14; HMM-score: 13.2)Central intermediary metabolism Other 2,4-diaminobutyrate 4-transaminase (TIGR00709; EC 2.6.1.-; HMM-score: 10.8)
- TheSEED: see SA1144
- PFAM: P-loop_NTPase (CL0023) IPPT; IPP transferase (PF01715; HMM-score: 267.1)and 7 moreIPT; Isopentenyl transferase (PF01745; HMM-score: 34.6)AAA_33; AAA domain (PF13671; HMM-score: 21.1)AAA_18; AAA domain (PF13238; HMM-score: 16.1)Zeta_toxin; Zeta toxin (PF06414; HMM-score: 14.5)RNA_helicase; RNA helicase (PF00910; HMM-score: 14.3)Cytidylate_kin; Cytidylate kinase (PF02224; HMM-score: 14.3)Hydin_ADK; Hydin Adenylate kinase-like domain (PF17213; HMM-score: 13.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors: Mg2+
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.071303
- TAT(Tat/SPI): 0.001764
- LIPO(Sec/SPII): 0.036275
- predicted transmembrane helices (TMHMM): 0
⊟Protein sequence[edit | edit source]
- MNKNKPFIVVIVGPTASGKTELSIELAKRINGEIISGDSMQVYKHMNIGTAKVTPEEMDGIPHHLIDILNPDDTFSAYEFKRLAEDLITDITNRGKVPIIAGGTGLYIQSLIYNYELEDETVTPAQLSIVKQKLSALEHLDNQQLHDYLAQFDAVSAENIHPNNRQRVLRAIEYYLKTKKLLSNRKKVQQFTENYDTLLLGIEMSRKTLYSRINKRVDIMLDHGLFREVQQLVEQGYESCQSMQAIGYKELIPVINGQMIYEDAVNDLKQHSRQYAKRQMTWFKNKMSVHWLDKENMSLQMMLDEITTQIK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
SA_RS00335 PBP2a family beta-lactam-resistant peptidoglycan transpeptidase MecA [1] (data from MRSA252) SA_RS01710 5'-nucleotidase, lipoprotein e(P4) family [1] (data from MRSA252) SA_RS02015 30S ribosomal protein S6 [1] (data from MRSA252) SA_RS02880 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB [1] (data from MRSA252) SA_RS02905 50S ribosomal protein L11 [1] (data from MRSA252) SA_RS02910 50S ribosomal protein L1 [1] (data from MRSA252) SA_RS02915 50S ribosomal protein L10 [1] (data from MRSA252) SA_RS02920 50S ribosomal protein L7/L12 [1] (data from MRSA252) SA_RS02945 30S ribosomal protein S12 [1] (data from MRSA252) SA_RS02950 30S ribosomal protein S7 [1] (data from MRSA252) SA_RS02960 elongation factor Tu [1] (data from MRSA252) SA_RS03645 hypothetical protein [1] (data from MRSA252) SA_RS03780 hypothetical protein [1] (data from MRSA252) SA_RS04575 NADH dehydrogenase [1] (data from MRSA252) SA_RS05135 bifunctional autolysin [1] (data from MRSA252) SA_RS05350 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SA_RS05355 pyruvate dehydrogenase E1 component subunit beta [1] (data from MRSA252) SA_RS05360 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [1] (data from MRSA252) SA_RS05365 dihydrolipoyl dehydrogenase [1] (data from MRSA252) SA_RS05860 cell division protein FtsZ [1] (data from MRSA252) SA_RS06050 50S ribosomal protein L28 [1] (data from MRSA252) SA_RS06140 50S ribosomal protein L19 [1] (data from MRSA252) SA_RS06240 UMP kinase [1] (data from MRSA252) SA_RS06295 translation initiation factor IF-2 [1] (data from MRSA252) SA_RS06315 30S ribosomal protein S15 [1] (data from MRSA252) SA_RS06325 ribonuclease J 2 [1] (data from MRSA252) SA_RS06460 tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA [1] (data from MRSA252) SA_RS06950 virulence factor B [1] (data from MRSA252) SA_RS07065 2-oxoglutarate dehydrogenase E1 component [1] (data from MRSA252) SA_RS07385 DNA-binding protein HU [1] (data from MRSA252) SA_RS07510 rRNA pseudouridine synthase [1] (data from MRSA252) SA_RS07845 DEAD/DEAH box family ATP-dependent RNA helicase [1] (data from MRSA252) SA_RS08030 RNA-binding protein [1] (data from MRSA252) SA_RS08285 50S ribosomal protein L27 [1] (data from MRSA252) SA_RS08295 50S ribosomal protein L21 [1] (data from MRSA252) SA_RS08460 50S ribosomal protein L20 [1] (data from MRSA252) SA_RS08465 50S ribosomal protein L35 [1] (data from MRSA252) SA_RS08470 translation initiation factor IF-3 [1] (data from MRSA252) SA_RS08505 aldehyde dehydrogenase [1] (data from MRSA252) SA_RS08545 isocitrate dehydrogenase (NADP(+)) [1] (data from MRSA252) SA_RS08560 pyruvate kinase [1] (data from MRSA252) SA_RS08600 universal stress protein [1] (data from MRSA252) SA_RS08675 30S ribosomal protein S4 [1] (data from MRSA252) SA_RS08800 hypothetical protein [1] (data from MRSA252) SA_RS08805 DUF948 domain containing protein [1] (data from MRSA252) SA_RS10965 ATP synthase subunit beta [1] (data from MRSA252) SA_RS11050 50S ribosomal protein L31 type B [1] (data from MRSA252) SA_RS11600 30S ribosomal protein S9 [1] (data from MRSA252) SA_RS11640 30S ribosomal protein S11 [1] (data from MRSA252) SA_RS11645 30S ribosomal protein S13 [1] (data from MRSA252) SA_RS11670 50S ribosomal protein L15 [1] (data from MRSA252) SA_RS11680 30S ribosomal protein S5 [1] (data from MRSA252) SA_RS11685 50S ribosomal protein L18 [1] (data from MRSA252) SA_RS11690 50S ribosomal protein L6 [1] (data from MRSA252) SA_RS11705 50S ribosomal protein L5 [1] (data from MRSA252) SA_RS11710 50S ribosomal protein L24 [1] (data from MRSA252) SA_RS11715 50S ribosomal protein L14 [1] (data from MRSA252) SA_RS11720 30S ribosomal protein S17 [1] (data from MRSA252) SA_RS11725 50S ribosomal protein L29 [1] (data from MRSA252) SA_RS11735 30S ribosomal protein S3 [1] (data from MRSA252) SA_RS11740 50S ribosomal protein L22 [1] (data from MRSA252) SA_RS11750 50S ribosomal protein L2 [1] (data from MRSA252) SA_RS11755 50S ribosomal protein L23 [1] (data from MRSA252) SA_RS11760 50S ribosomal protein L4 [1] (data from MRSA252) SA_RS11765 50S ribosomal protein L3 [1] (data from MRSA252) SA_RS11830 lipid II:glycine glycyltransferase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 1.39 1.40 1.41 1.42 1.43 1.44 1.45 1.46 1.47 1.48 1.49 1.50 1.51 1.52 1.53 1.54 1.55 1.56 1.57 1.58 1.59 1.60 1.61 1.62 1.63 1.64 1.65 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)