NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2206 [new locus tag: SACOL_RS11615 ]
- pan locus tag?: SAUPAN005634000
- symbol: rpsI
- pan gene symbol?: rpsI
- synonym:
- product: 30S ribosomal protein S9
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2206 [new locus tag: SACOL_RS11615 ]
- symbol: rpsI
- product: 30S ribosomal protein S9
- replicon: chromosome
- strand: -
- coordinates: 2288674..2289072
- length: 399
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237881 NCBI
- RefSeq: YP_187016 NCBI
- BioCyc: see SACOL_RS11615
- MicrobesOnline: 913691 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGACTTTGGCACAAGTTGAATATAGAGGCACAGGCCGTCGTAAAAACTCAGTAGCACGT
GTACGTTTAGTACCAGGTGAAGGTAACATCACAGTTAATAACCGTGACGTACGCGAATAC
TTACCATTCGAATCATTAATTTTAGACTTAAACCAACCATTTGATGTAACTGAAACTAAA
GGTAACTATGATGTTTTAGTTAACGTTCATGGTGGTGGTTTCACTGGACAAGCTCAAGCT
ATCCGTCACGGAATCGCTCGTGCATTATTAGAAGCAGATCCTGAATACAGAGGTTCTTTA
AAACGCGCTGGATTACTTACTCGTGACCCACGTATGAAAGAACGTAAAAAACCAGGTCTT
AAAGCAGCTCGTCGTTCACCTCAATTCTCAAAACGTTAA60
120
180
240
300
360
399
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2206 [new locus tag: SACOL_RS11615 ]
- symbol: RpsI
- description: 30S ribosomal protein S9
- length: 132
- theoretical pI: 11.1618
- theoretical MW: 14829.8
- GRAVY: -0.706061
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS9 (TIGR03627; HMM-score: 70.2)
- TheSEED :
- SSU ribosomal protein S9p (S16e)
- PFAM: S5 (CL0329) Ribosomal_S9; Ribosomal protein S9/S16 (PF00380; HMM-score: 155.4)and 1 moreno clan defined DUF2135; Uncharacterized protein conserved in bacteria (DUF2135) (PF09906; HMM-score: 12.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006703
- TAT(Tat/SPI): 0.000253
- LIPO(Sec/SPII): 0.000676
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTLAQVEYRGTGRRKNSVARVRLVPGEGNITVNNRDVREYLPFESLILDLNQPFDVTETKGNYDVLVNVHGGGFTGQAQAIRHGIARALLEADPEYRGSLKRAGLLTRDPRMKERKKPGLKAARRSPQFSKR
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3] [4]
- quantitative data / protein copy number per cell: 7364 [5]
- interaction partners:
SACOL0842 (eno) phosphopyruvate hydratase [6] (data from MRSA252) SACOL1513 (hup) DNA-binding protein HU [6] (data from MRSA252) SACOL1390 (parC) DNA topoisomerase IV subunit A [6] (data from MRSA252) SACOL2119 (pyrG) CTP synthetase [6] (data from MRSA252) SACOL0584 (rplA) 50S ribosomal protein L1 [6] (data from MRSA252) SACOL2236 (rplB) 50S ribosomal protein L2 [6] (data from MRSA252) SACOL2238 (rplD) 50S ribosomal protein L4 [6] (data from MRSA252) SACOL2227 (rplE) 50S ribosomal protein L5 [6] (data from MRSA252) SACOL2224 (rplF) 50S ribosomal protein L6 [6] (data from MRSA252) SACOL0585 (rplJ) 50S ribosomal protein L10 [6] (data from MRSA252) SACOL0583 (rplK) 50S ribosomal protein L11 [6] (data from MRSA252) SACOL0586 (rplL) 50S ribosomal protein L7/L12 [6] (data from MRSA252) SACOL2220 (rplO) 50S ribosomal protein L15 [6] (data from MRSA252) SACOL2232 (rplP) 50S ribosomal protein L16 [6] (data from MRSA252) SACOL2212 (rplQ) 50S ribosomal protein L17 [6] (data from MRSA252) SACOL1257 (rplS) 50S ribosomal protein L19 [6] (data from MRSA252) SACOL1702 (rplU) 50S ribosomal protein L21 [6] (data from MRSA252) SACOL2234 (rplV) 50S ribosomal protein L22 [6] (data from MRSA252) SACOL2237 (rplW) 50S ribosomal protein L23 [6] (data from MRSA252) SACOL1769 (rpsD) 30S ribosomal protein S4 [6] (data from MRSA252) SACOL2222 (rpsE) 30S ribosomal protein S5 [6] (data from MRSA252) SACOL0437 (rpsF) 30S ribosomal protein S6 [6] (data from MRSA252) SACOL0592 (rpsG) 30S ribosomal protein S7 [6] (data from MRSA252) SACOL2214 (rpsK) 30S ribosomal protein S11 [6] (data from MRSA252) SACOL2215 (rpsM) 30S ribosomal protein S13 [6] (data from MRSA252) SACOL2230 (rpsQ) 30S ribosomal protein S17 [6] (data from MRSA252) SACOL0303 5'-nucleotidase [6] (data from MRSA252) SACOL1098 hypothetical protein [6] (data from MRSA252) SACOL1753 universal stress protein [6] (data from MRSA252) SACOL2325 LysR family transcriptional regulator [6] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: L13 leader (transcription termination) regulon
L13 leader (RNA) important in Ribosome biogenesis; transcription unit transferred from N315 data RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 8.35 h [7]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Annette Dreisbach, Kristina Hempel, Girbe Buist, Michael Hecker, Dörte Becher, Jan Maarten van Dijl
Profiling the surfacome of Staphylococcus aureus.
Proteomics: 2010, 10(17);3082-96
[PubMed:20662103] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 6.00 6.01 6.02 6.03 6.04 6.05 6.06 6.07 6.08 6.09 6.10 6.11 6.12 6.13 6.14 6.15 6.16 6.17 6.18 6.19 6.20 6.21 6.22 6.23 6.24 6.25 6.26 6.27 6.28 6.29 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)