From AureoWiki
Jump to navigation Jump to search
m (Text replacement - "<protect> =Summary= * <aureodatabase>organism" to "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism")
m (Text replacement - "gene Genbank" to "gene RefSeq")
Line 39: Line 39:


* <aureodatabase>gene GI</aureodatabase>
* <aureodatabase>gene GI</aureodatabase>
* <aureodatabase>gene Genbank</aureodatabase>
* <aureodatabase>gene RefSeq</aureodatabase>
</protect>
</protect>
   
   

Revision as of 04:14, 11 March 2016

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1727 [new locus tag: SACOL_RS08830 ]
  • symbol: infC
  • product: translation initiation factor IF-3
  • replicon: chromosome
  • strand: -
  • coordinates: 1757041..1757568
  • length: 528
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID: 3237740 NCBI
  • RefSeq: YP_186565 NCBI

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    GTGTCAACCATAGCAAAAGATCAAACTCAAATCAATGACAAAATTCGTGCAAAAGAATTA
    CGTTTAATCGGTCAAGATGGTGAACAAATTGGTGTTAAATCAAAGCGTGAAGCTTTAGAA
    ATGGCTGAACGTGTAGATTTAGACTTAGTGGTCGTTGCACCGAATGCGAAACCACCAGTT
    GCAAGAATTATGGATTACGGTAAATTCAAATTCGAACAACAGAAAAAAGAAAAAGAAATG
    AAAAAGAAACAAAAAATTATCAATGTTAAAGAAATTCGTTTAAGTCCAACAATTGAGGAA
    CATGATTTCCAAACGAAGTTGAAAAACGGACGTAAATTCTTAACTAAAGGCGATAAATGT
    AAAGTATCTATTCGTTTCAGAGGGCGTGCCATTACGCATAAGGAAATTGGTCAACGTGTG
    CTAGAAAAATATGCAGATGAATGCAAAGATATAGCAACAGTTGAACAAAAACCTAAAATG
    GACGGGCGTCAAATGTTTATCATGTTAGCGCCAACAGCTGAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    528

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1727 [new locus tag: SACOL_RS08830 ]
  • symbol: InfC
  • description: translation initiation factor IF-3
  • length: 175
  • theoretical pI: 10.4435
  • theoretical MW: 20213.6
  • GRAVY: -0.782857

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Translation factors translation initiation factor IF-3 (TIGR00168; HMM-score: 231.9)
  • TheSEED  :
    • Translation initiation factor 3
    Protein Metabolism Protein biosynthesis Translation initiation factors bacterial  Translation initiation factor 3
    and 1 more
    Virulence Virulence - no subcategory Mycobacterium virulence operon involved in protein synthesis (LSU ribosomal proteins)  Translation initiation factor 3
  • PFAM:
    no clan defined IF3_C; Translation initiation factor IF-3, C-terminal domain (PF00707; HMM-score: 130.5)
    IF3_N; Translation initiation factor IF-3, N-terminal domain (PF05198; HMM-score: 106)
    and 1 more
    NTP_transf (CL0260) NTP_transf_2; Nucleotidyltransferase domain (PF01909; HMM-score: 15.9)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:
    SACOL1513(hup)DNA-binding protein HU  [1] (data from MRSA252)
    SACOL0584(rplA)50S ribosomal protein L1  [1] (data from MRSA252)
    SACOL2236(rplB)50S ribosomal protein L2  [1] (data from MRSA252)
    SACOL2239(rplC)50S ribosomal protein L3  [1] (data from MRSA252)
    SACOL2238(rplD)50S ribosomal protein L4  [1] (data from MRSA252)
    SACOL2224(rplF)50S ribosomal protein L6  [1] (data from MRSA252)
    SACOL0585(rplJ)50S ribosomal protein L10  [1] (data from MRSA252)
    SACOL0586(rplL)50S ribosomal protein L7/L12  [1] (data from MRSA252)
    SACOL2220(rplO)50S ribosomal protein L15  [1] (data from MRSA252)
    SACOL2232(rplP)50S ribosomal protein L16  [1] (data from MRSA252)
    SACOL1257(rplS)50S ribosomal protein L19  [1] (data from MRSA252)
    SACOL1702(rplU)50S ribosomal protein L21  [1] (data from MRSA252)
    SACOL2234(rplV)50S ribosomal protein L22  [1] (data from MRSA252)
    SACOL2237(rplW)50S ribosomal protein L23  [1] (data from MRSA252)
    SACOL2233(rpsC)30S ribosomal protein S3  [1] (data from MRSA252)
    SACOL1769(rpsD)30S ribosomal protein S4  [1] (data from MRSA252)
    SACOL2222(rpsE)30S ribosomal protein S5  [1] (data from MRSA252)
    SACOL0437(rpsF)30S ribosomal protein S6  [1] (data from MRSA252)
    SACOL0592(rpsG)30S ribosomal protein S7  [1] (data from MRSA252)
    SACOL2206(rpsI)30S ribosomal protein S9  [1] (data from MRSA252)
    SACOL2240(rpsJ)30S ribosomal protein S10  [1] (data from MRSA252)
    SACOL2214(rpsK)30S ribosomal protein S11  [1] (data from MRSA252)
    SACOL0591(rpsL)30S ribosomal protein S12  [1] (data from MRSA252)
    SACOL1292(rpsO)30S ribosomal protein S15  [1] (data from MRSA252)
    SACOL2230(rpsQ)30S ribosomal protein S17  [1] (data from MRSA252)
    SACOL2235(rpsS)30S ribosomal protein S19  [1] (data from MRSA252)
    SACOL03035'-nucleotidase  [1] (data from MRSA252)
    SACOL1753universal stress protein  [1] (data from MRSA252)

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004901
    • TAT(Tat/SPI): 0.000734
    • LIPO(Sec/SPII): 0.000838
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 57650552 NCBI
  • UniProt: Q5HF92 UniProt
  • protein Genbank : _
  • RefSeq: YP_186565 NCBI

Protein sequence[edit | edit source]

  • MSTIAKDQTQINDKIRAKELRLIGQDGEQIGVKSKREALEMAERVDLDLVVVAPNAKPPVARIMDYGKFKFEQQKKEKEMKKKQKIINVKEIRLSPTIEEHDFQTKLKNGRKFLTKGDKCKVSIRFRGRAITHKEIGQRVLEKYADECKDIATVEQKPKMDGRQMFIMLAPTAEK

Peptides[edit | edit source]

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • sigma factors : _
  • regulator: L20 leader (transcription termination) regulon
    L20 leader(RNA)important in Ribosome biogenesis; regulatory site identified based on RegPrecise data for N315 RegPrecise 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: 12.8 h [2]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]