Jump to navigation
Jump to search
(Created page with "<protect> =Summary= * <aureodatabase>organism</aureodatabase> * <aureodatabase>locus</aureodatabase> * <aureodatabase>pan locus</aureodatabase> * <aureodatabase>gene symbol</...") |
m (Text replacement - "title=SACOL0100" to "title={{PAGENAMEE}}") |
||
Line 43: | Line 43: | ||
==Phenotype== | ==Phenotype== | ||
</protect> | </protect> | ||
* Share your knowledge and add information here. [<span class="plainlinks">[http://www.protecs.uni-greifswald.de/aureowiki/index.php?title= | * Share your knowledge and add information here. [<span class="plainlinks">[http://www.protecs.uni-greifswald.de/aureowiki/index.php?title={{PAGENAMEE}}&action=edit§ion=6 edit]</span>] | ||
<protect> | <protect> |
Revision as of 14:24, 28 October 2014
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1727 [new locus tag: SACOL_RS08830 ]
- pan locus tag?: SAUPAN004299000
- symbol: infC
- pan gene symbol?: infC
- synonym:
- product: translation initiation factor IF-3
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1727 [new locus tag: SACOL_RS08830 ]
- symbol: infC
- product: translation initiation factor IF-3
- replicon: chromosome
- strand: -
- coordinates: 1757041..1757568
- length: 528
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237740 NCBI
- gene Genbank : _
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481GTGTCAACCATAGCAAAAGATCAAACTCAAATCAATGACAAAATTCGTGCAAAAGAATTA
CGTTTAATCGGTCAAGATGGTGAACAAATTGGTGTTAAATCAAAGCGTGAAGCTTTAGAA
ATGGCTGAACGTGTAGATTTAGACTTAGTGGTCGTTGCACCGAATGCGAAACCACCAGTT
GCAAGAATTATGGATTACGGTAAATTCAAATTCGAACAACAGAAAAAAGAAAAAGAAATG
AAAAAGAAACAAAAAATTATCAATGTTAAAGAAATTCGTTTAAGTCCAACAATTGAGGAA
CATGATTTCCAAACGAAGTTGAAAAACGGACGTAAATTCTTAACTAAAGGCGATAAATGT
AAAGTATCTATTCGTTTCAGAGGGCGTGCCATTACGCATAAGGAAATTGGTCAACGTGTG
CTAGAAAAATATGCAGATGAATGCAAAGATATAGCAACAGTTGAACAAAAACCTAAAATG
GACGGGCGTCAAATGTTTATCATGTTAGCGCCAACAGCTGAAAAATAA60
120
180
240
300
360
420
480
528
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1727 [new locus tag: SACOL_RS08830 ]
- symbol: InfC
- description: translation initiation factor IF-3
- length: 175
- theoretical pI: 10.4435
- theoretical MW: 20213.6
- GRAVY: -0.782857
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Translation factors translation initiation factor IF-3 (TIGR00168; HMM-score: 231.9)
- TheSEED :
- Translation initiation factor 3
Protein Metabolism Protein biosynthesis Translation initiation factors bacterial Translation initiation factor 3and 1 more - PFAM: no clan defined IF3_C; Translation initiation factor IF-3, C-terminal domain (PF00707; HMM-score: 130.5)IF3_N; Translation initiation factor IF-3, N-terminal domain (PF05198; HMM-score: 106)and 1 moreNTP_transf (CL0260) NTP_transf_2; Nucleotidyltransferase domain (PF01909; HMM-score: 15.9)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
SACOL1513 (hup) DNA-binding protein HU [1] (data from MRSA252) SACOL0584 (rplA) 50S ribosomal protein L1 [1] (data from MRSA252) SACOL2236 (rplB) 50S ribosomal protein L2 [1] (data from MRSA252) SACOL2239 (rplC) 50S ribosomal protein L3 [1] (data from MRSA252) SACOL2238 (rplD) 50S ribosomal protein L4 [1] (data from MRSA252) SACOL2224 (rplF) 50S ribosomal protein L6 [1] (data from MRSA252) SACOL0585 (rplJ) 50S ribosomal protein L10 [1] (data from MRSA252) SACOL0586 (rplL) 50S ribosomal protein L7/L12 [1] (data from MRSA252) SACOL2220 (rplO) 50S ribosomal protein L15 [1] (data from MRSA252) SACOL2232 (rplP) 50S ribosomal protein L16 [1] (data from MRSA252) SACOL1257 (rplS) 50S ribosomal protein L19 [1] (data from MRSA252) SACOL1702 (rplU) 50S ribosomal protein L21 [1] (data from MRSA252) SACOL2234 (rplV) 50S ribosomal protein L22 [1] (data from MRSA252) SACOL2237 (rplW) 50S ribosomal protein L23 [1] (data from MRSA252) SACOL2233 (rpsC) 30S ribosomal protein S3 [1] (data from MRSA252) SACOL1769 (rpsD) 30S ribosomal protein S4 [1] (data from MRSA252) SACOL2222 (rpsE) 30S ribosomal protein S5 [1] (data from MRSA252) SACOL0437 (rpsF) 30S ribosomal protein S6 [1] (data from MRSA252) SACOL0592 (rpsG) 30S ribosomal protein S7 [1] (data from MRSA252) SACOL2206 (rpsI) 30S ribosomal protein S9 [1] (data from MRSA252) SACOL2240 (rpsJ) 30S ribosomal protein S10 [1] (data from MRSA252) SACOL2214 (rpsK) 30S ribosomal protein S11 [1] (data from MRSA252) SACOL0591 (rpsL) 30S ribosomal protein S12 [1] (data from MRSA252) SACOL1292 (rpsO) 30S ribosomal protein S15 [1] (data from MRSA252) SACOL2230 (rpsQ) 30S ribosomal protein S17 [1] (data from MRSA252) SACOL2235 (rpsS) 30S ribosomal protein S19 [1] (data from MRSA252) SACOL0303 5'-nucleotidase [1] (data from MRSA252) SACOL1753 universal stress protein [1] (data from MRSA252)
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004901
- TAT(Tat/SPI): 0.000734
- LIPO(Sec/SPII): 0.000838
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSTIAKDQTQINDKIRAKELRLIGQDGEQIGVKSKREALEMAERVDLDLVVVAPNAKPPVARIMDYGKFKFEQQKKEKEMKKKQKIINVKEIRLSPTIEEHDFQTKLKNGRKFLTKGDKCKVSIRFRGRAITHKEIGQRVLEKYADECKDIATVEQKPKMDGRQMFIMLAPTAEK
⊟Peptides[edit | edit source]
- experimentally validated: PeptideAtlas
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: rplT < rpmI < infC
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator: L20 leader (transcription termination) regulon
L20 leader (RNA) important in Ribosome biogenesis; regulatory site identified based on RegPrecise data for N315 RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: 12.8 h [2]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)