From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1968 [new locus tag: SACOL_RS10290 ]
  • pan locus tag?: SAUPAN004936000
  • symbol: SACOL1968
  • pan gene symbol?: hisR
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1968 [new locus tag: SACOL_RS10290 ]
  • symbol: SACOL1968
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2031752..2032054
  • length: 303
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGCAAATTGAAAAATTACGAGGTGCAGCGTTAGATGAATTGTTTGATGCAATACTAACG
    TTAGAAAATAGAGAAGAATGTTACCAATTTTTCGATGATTTGTGTACTGTAAATGAAATT
    CAATCACTGTCTCAAAGATTACAAGTTGCTAAAATGATTAAGCAAGGTTATACCTATGCA
    ACGATTGAACAAGAATCTGGAGCATCGACTGCAACGATTTCTAGAGTGAAGCGTTCATTA
    CAATGGGGTAATGATGCTTATACAATGATTTTAGATCGTATGAATATTGAAACAAATGAA
    TAA
    60
    120
    180
    240
    300
    303

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1968 [new locus tag: SACOL_RS10290 ]
  • symbol: SACOL1968
  • description: hypothetical protein
  • length: 100
  • theoretical pI: 4.27043
  • theoretical MW: 11518.9
  • GRAVY: -0.402

⊟Function[edit | edit source]

  • TIGRFAM:
    Unknown function General TrpR homolog YerC/YecD (TIGR02531; HMM-score: 162.2)
    and 2 more
    Metabolism Amino acid biosynthesis Aromatic amino acid family trp operon repressor (TIGR01321; HMM-score: 20.8)
    Signal transduction Regulatory functions DNA interactions trp operon repressor (TIGR01321; HMM-score: 20.8)
  • TheSEED  :
    • His repressor
    CBSS-393121.3.peg.1913  His repressor
  • PFAM:
    HTH (CL0123) Trp_repressor; Trp repressor protein (PF01371; HMM-score: 117.4)
    and 4 more
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 29.5)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 19.5)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 14.5)
    HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 11.9)

⊟Structure, modifications & cofactors[edit | edit source]

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003872
    • TAT(Tat/SPI): 0.000703
    • LIPO(Sec/SPII): 0.000578
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MQIEKLRGAALDELFDAILTLENREECYQFFDDLCTVNEIQSLSQRLQVAKMIKQGYTYATIEQESGASTATISRVKRSLQWGNDAYTMILDRMNIETNE

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2]
  • quantitative data / protein copy number per cell: 275 [3]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: HisR* (repression) regulon
    HisR*(TF)important in Histidine biosynthesis; RegPrecise 

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  3. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Semen A Leyn, Marat D Kazanov, Natalia V Sernova, Ekaterina O Ermakova, Pavel S Novichkov, Dmitry A Rodionov
Genomic reconstruction of the transcriptional regulatory network in Bacillus subtilis.
J Bacteriol: 2013, 195(11);2463-73
[PubMed:23504016] [WorldCat.org] [DOI] (I p)

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SACOL1968&oldid=94296"