NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

organism: Staphylococcus aureus NCTC8325

locus tag: SAOUHSC_00748

pan locus tag^?: SAUPAN002639000

symbol: SAOUHSC_00748

pan gene symbol^?: sstC

synonym:
product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

type: CDS
locus tag: SAOUHSC_00748
symbol: SAOUHSC_00748
product: hypothetical protein
replicon: chromosome
strand: +
coordinates: 732955..733716
length: 762
essential: no DEG other strains

⊟Accession numbers[edit | edit source]

Gene ID: 3919510 NCBI
RefSeq: YP_499308 NCBI
BioCyc: G1I0R-701 BioCyc
MicrobesOnline: 1289218 MicrobesOnline

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

1
61
121
181
241
301
361
421
481
541
601
661
721
ATGATTCAAGTTGAAAATTTAACTAAAACTATAAATAATCAAATGATATTGGAAGATATT
AGCATAGATATCGAAAAAGGTAAATTGACTTCTTTAATTGGACCTAATGGTGCGGGTAAG
AGTACTTTACTTTCAGCGATATGTAGGTTAATTCGTTTTGAGAACGGTGAAGTGAAAATA
GATGGACAGCTCATGTCTGATTATAAAAATAATGACTTGTCGAAAAAAATATCTATATTA
AAACAAACAAACCATACTGAAATGAATATTACGGTAGAGCAGTTGGTAAACTTTGGACGA
TTCCCTTATTCTAAAGGTCGTTTGACGAAAGAGGATCATGATATTGTCAATGATGCGCTA
GATTTGTTGCAACTACAAGATATCAGAAATCGTAATATTAAGTCATTATCTGGTGGACAA
CGTCAGCGTGCATACATTGCAATGACAATAGCACAAGATACTGAATATATTTTGCTAGAT
GAACCATTAAATAATTTAGATATGAAGCATGCTGTTCAAATTATGCAAACGTTAAAAATG
TTAGCGCATAAAATGAATAAAGCGATTGTCATTGTGTTACATGATATTAACTTTGCGTCC
TGTTATTCAGATCAGATTGTAGCATTGAAAAACGGACAACTAGTTAAGTCAGATTTGAAA
GATAATGTCATTCAAAGTAGTGTTTTAAGTGATTTATATGACATGAATATTCAAATTGAA
CATATAAGAAATCAAAGGATTTGTTTATATTTTAAGGATTGA
60
120
180
240
300
360
420
480
540
600
660
720
762

⊟Protein[edit | edit source]

⊟General[edit | edit source]

locus tag: SAOUHSC_00748
symbol: SAOUHSC_00748
description: hypothetical protein
length: 253
theoretical pI: 7.12777
theoretical MW: 28834.2
GRAVY: -0.266008

⊟Function[edit | edit source]

⊞⊞TIGRFAM:
proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 174.9)
Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 159.3)
and 78 more
Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 131.9)
Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 128.7)
Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 128)
Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 122.2)
Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 118.6)
Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 117.2)
Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 115.2)
Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 114.9)
Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 114.4)
Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 114.1)
Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 110.6)
Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 110.6)
Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 109.5)
Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 109.3)
Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 107.6)
Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 107.6)
Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 107.6)
Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 105.3)
Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 104.9)
Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 103)
2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 101.4)
Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 101.3)
thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 101.1)
Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 99.8)
ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 98.6)
ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 96.8)
thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 96.3)
gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 96)
Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 94.9)
Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 94.4)
Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 94.4)
Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 90.9)
Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 90.9)
Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 89.8)
Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 89.8)
lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 89.1)
ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 88.1)
Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 87.6)
Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 86.1)
D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 85.8)
Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 85.7)
Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 85.7)
Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 83.1)
Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 83.1)
Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 82.8)
Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 79.3)
ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 76.4)
Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 74.9)
Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 74.7)
Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 73.9)
Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 73.9)
Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 73.9)
Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 71.2)
Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 71.2)
Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 69.2)
Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 69.2)
Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 66.8)
Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 66.8)
phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 61.2)
Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 59.9)
Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 56)
Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 54.7)
Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 54.1)
Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 53.2)
Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 50.4)
Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 42.5)
Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 42.5)
Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 35.5)
Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 30.3)
Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 20.8)
Genetic information processing DNA metabolism DNA replication, recombination, and repair exonuclease SbcC (TIGR00618; HMM-score: 16.8)
Genetic information processing DNA metabolism DNA replication, recombination, and repair DnaA regulatory inactivator Hda (TIGR03420; HMM-score: 16.1)
Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA repair protein RecN (TIGR00634; HMM-score: 15.6)
Metabolism Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 14.8)
Signal transduction Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 14.8)
Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 14.2)
Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 14.2)
Metabolism Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 12.2)
⊞⊞
TheSEED :
- Iron compound ABC uptake transporter ATP-binding protein
Iron acquisition and metabolism Iron acquisition and metabolism - no subcategory Heme, hemin uptake and utilization systems in GramPositives Iron compound ABC uptake transporter ATP-binding protein
and 3 more
Iron acquisition and metabolism Iron acquisition and metabolism - no subcategory Hemin transport system Iron compound ABC uptake transporter ATP-binding protein
Iron acquisition and metabolism Iron acquisition and metabolism - no subcategory Iron acquisition in Streptococcus Iron compound ABC uptake transporter ATP-binding protein
Stress Response Stress Response - no subcategory Flavohaemoglobin Iron compound ABC uptake transporter ATP-binding protein
⊞⊞PFAM:
P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 116)
and 24 more
AAA_15; AAA ATPase domain (PF13175; HMM-score: 41.2)
AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 37.2)
SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 36.2)
AAA_23; AAA domain (PF13476; HMM-score: 36)
AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 26.3)
RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 20.7)
AAA_27; AAA domain (PF13514; HMM-score: 18.8)
AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 17.7)
ABC_ATPase; P-loop domain (PF09818; HMM-score: 17.3)
EF_hand (CL0220) CAPN13-like_C_EFh; Calpain-13-like, C-terminal EF-hand (PF21875; HMM-score: 17.1)
P-loop_NTPase (CL0023) SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 16.2)
AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 15.4)
cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 15.4)
AAA_25; AAA domain (PF13481; HMM-score: 15.4)
AAA_16; AAA ATPase domain (PF13191; HMM-score: 15.3)
AAA_14; AAA domain (PF13173; HMM-score: 14.9)
AAA_30; AAA domain (PF13604; HMM-score: 14.6)
DUF5906; Family of unknown function (DUF5906) (PF19263; HMM-score: 14.4)
AAA_19; AAA domain (PF13245; HMM-score: 13.9)
NTPase_1; NTPase (PF03266; HMM-score: 13.8)
MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13.1)
TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 12.9)
AAA_33; AAA domain (PF13671; HMM-score: 12.3)
NACHT; NACHT domain (PF05729; HMM-score: 12.1)

⊟Structure, modifications & cofactors[edit | edit source]

domains:
modifications:
cofactors:
effectors:

⊟Localization[edit | edit source]

⊞⊞
PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.04
- Cytoplasmic Membrane Score: 9.96
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
⊞⊞
DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.3053
- Cytoplasmic Membrane Score: 0.6886
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0059
⊞⊞
LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
⊞⊞
SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.008869
- TAT(Tat/SPI): 0.000495
- LIPO(Sec/SPII): 0.000362
predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

GI: 88194513 NCBI
RefSeq: YP_499308 NCBI
UniProt: Q2G072 UniProt
STRING: 93061.SAOUHSC_00748 STRING

⊟Protein sequence[edit | edit source]

MIQVENLTKTINNQMILEDISIDIEKGKLTSLIGPNGAGKSTLLSAICRLIRFENGEVKIDGQLMSDYKNNDLSKKISILKQTNHTEMNITVEQLVNFGRFPYSKGRLTKEDHDIVNDALDLLQLQDIRNRNIKSLSGGQRQRAYIAMTIAQDTEYILLDEPLNNLDMKHAVQIMQTLKMLAHKMNKAIVIVLHDINFASCYSDQIVALKNGQLVKSDLKDNVIQSSVLSDLYDMNIQIEHIRNQRICLYFKD

⊟Experimental data[edit | edit source]

experimentally validated: PeptideAtlas ^[1] ^[2]
protein localization:
quantitative data / protein copy number per cell:
⊟⊟interaction partners:
SAOUHSC_01794 glyceraldehyde 3-phosphate dehydrogenase 2 ^[3] (data from MRSA252)
SAOUHSC_02860 HMG-CoA synthase ^[3] (data from MRSA252)

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

MicrobesOnline: SAOUHSC_00746 > SAOUHSC_00747 > SAOUHSC_00748 > SAOUHSC_00749
predicted SigA promoter ^[4] : SAOUHSC_00746 > SAOUHSC_00747 > SAOUHSC_00748 > S294 > SAOUHSC_00749

⊟Regulation[edit | edit source]

data available for N315

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

Aureolib: no data available

⊟Protein stability[edit | edit source]

half-life: no data available

⊞Biological Material[edit | edit source]

⊞Other Information[edit | edit source]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p)
↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e)
↑ ^{Jump up to: 3.0} ^3.1 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)
↑ ^{Jump up to: 4.0} ^4.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

[pubmed26224020-1] Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p)

[pubmed28887440-2] Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e)

[pubmed21166474-3] {Jump up to: 3.0} ^3.1 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)

[pubmed27035918-4] {Jump up to: 4.0} ^4.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)

[1]

[2]

[3]

[4]

SAOUHSC_01794		glyceraldehyde 3-phosphate dehydrogenase 2 ^[3] (data from MRSA252)
SAOUHSC_02860		HMG-CoA synthase ^[3] (data from MRSA252)

Search

Navigation menu

Links

⊟Summary[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟DNA sequence[edit | edit source]

⊟Protein[edit | edit source]

⊟General[edit | edit source]

⊟Function[edit | edit source]

⊟Structure, modifications & cofactors[edit | edit source]

⊟Localization[edit | edit source]

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

⊟Experimental data[edit | edit source]

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

⊟Summary[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟DNA sequence[edit | edit source]

⊟Protein[edit | edit source]

⊟General[edit | edit source]

⊟Function[edit | edit source]

⊟Structure, modifications & cofactors[edit | edit source]

⊟Localization[edit | edit source]

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

⊟Experimental data[edit | edit source]

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]