UndoCtrl+ZRedoCtrl+Shift+Z, Ctrl+Y
LinkCtrl+K

Links

Link important words to other wiki articles or even other websites. It will help readers understand the context.

Okay, got it
Special character
Edit notices
Save changes…Alt+S
ParagraphCtrl+0HeadingCtrl+2Sub-heading 1Ctrl+3Sub-heading 2Ctrl+4Sub-heading 3Ctrl+5Sub-heading 4Ctrl+6Header cellContent cellPreformattedCtrl+7Block quoteCtrl+8Page titleCtrl+1
BoldCtrl+BItalicCtrl+ISuperscriptCtrl+.SubscriptCtrl+,Computer codeCtrl+Shift+6StrikethroughCtrl+Shift+5UnderlineCtrl+UBigSmallLanguageRemoveCtrl+\, Ctrl+MMore
PubMedBasicCtrl+Shift+KRe-useMore
Bullet listNumbered listDecrease indentationShift+Tab, Ctrl+[Increase indentationTab, Ctrl+]More
Images and mediaTemplateTableCommentGalleryYour signatureReferences listMore
Read the user guideKeyboard shortcutsCtrl+/, Ctrl+Shift+/Toolbar searchCtrl+Shift+P, Ctrl+Alt+Shift+P
More
2 noticesClose
Warning: You are not logged in. Your IP address will be publicly visible if you make any edits. If you log in or create an account, your edits will be attributed to your username, along with other benefits.

You are using a browser which is not officially supported by this editor.

OptionsCategoriesPage settingsAdvanced settingsLanguagesTemplates used⧼visualeditor-changedir-rtl⧽Ctrl+Shift+XFind and replaceCtrl+FMore
Visual editingSource editingMore
From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1310 [new locus tag: SACOL_RS06685 ]
  • pan locus tag?: SAUPAN003595000
  • symbol: SACOL1310
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1310 [new locus tag: SACOL_RS06685 ]
  • symbol: SACOL1310
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1327297..1327590
  • length: 294
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAAGACACATTAATGAGTATACAAATAATTCCTAAAACACCAAACAATGACAATGTT
    ATACCTTACGTAGACGAGGCGATTAAAATAATTGACGAATCTGGTTTGCATTTTAGAGTA
    GGTCCGTTAGAAACGACAGTACAAGGAAATATGAATGAATGTTTAATTTTAATACAATCA
    TTAAATGAACGAATGGTGGAACTTGAATGTCCAAGTATTATTAGCCAAGTTAAGTTTTAT
    CATGTGCCAGATGGCATCACTATTGAAACTTTAACTGAAAAATATGATGAATAA
    60
    120
    180
    240
    294

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1310 [new locus tag: SACOL_RS06685 ]
  • symbol: SACOL1310
  • description: hypothetical protein
  • length: 97
  • theoretical pI: 4.15885
  • theoretical MW: 11034.6
  • GRAVY: -0.119588

⊟Function[edit | edit source]

  • TIGRFAM:
    Unknown function General uncharacterized protein, MTH1187 family (TIGR00106; HMM-score: 31.3)
  • TheSEED  :
    • Cytoplasmic thiamin-binding component of thiamin ABC transporter, COG0011 family
  • PFAM:
    MTH1187-YkoF (CL0360) Thiamine_BP; Thiamine-binding protein (PF01910; HMM-score: 59.7)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞⊞PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • ⊞⊞DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9979
    • Cytoplasmic Membrane Score: 0.0004
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0016
  • ⊞⊞LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • ⊞⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004718
    • TAT(Tat/SPI): 0.000076
    • LIPO(Sec/SPII): 0.000233
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKDTLMSIQIIPKTPNNDNVIPYVDEAIKIIDESGLHFRVGPLETTVQGNMNECLILIQSLNERMVELECPSIISQVKFYHVPDGITIETLTEKYDE

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2]
  • quantitative data / protein copy number per cell: 910 [3]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: 19.1 h [4]

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  3. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  4. ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SACOL1310&oldid=87873"
Insert paragraph

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1310 [new locus tag: SACOL_RS06685 ]
  • pan locus tag?: SAUPAN003595000
  • symbol: SACOL1310
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

Insert paragraph

⊟Genome View[edit | edit source]

Insert paragraph

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1310 [new locus tag: SACOL_RS06685 ]
  • symbol: SACOL1310
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1327297..1327590
  • length: 294
  • essential: unknown other strains

Insert paragraph

⊟Accession numbers[edit | edit source]

Insert paragraph

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAAGACACATTAATGAGTATACAAATAATTCCTAAAACACCAAACAATGACAATGTT
    ATACCTTACGTAGACGAGGCGATTAAAATAATTGACGAATCTGGTTTGCATTTTAGAGTA
    GGTCCGTTAGAAACGACAGTACAAGGAAATATGAATGAATGTTTAATTTTAATACAATCA
    TTAAATGAACGAATGGTGGAACTTGAATGTCCAAGTATTATTAGCCAAGTTAAGTTTTAT
    CATGTGCCAGATGGCATCACTATTGAAACTTTAACTGAAAAATATGATGAATAA
    60
    120
    180
    240
    294

Insert paragraph

This data comes from external databases and cannot be edited.

Insert paragraph

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1310 [new locus tag: SACOL_RS06685 ]
  • symbol: SACOL1310
  • description: hypothetical protein
  • length: 97
  • theoretical pI: 4.15885
  • theoretical MW: 11034.6
  • GRAVY: -0.119588

Insert paragraph

⊟Function[edit | edit source]

  • TIGRFAM:
    Unknown function General uncharacterized protein, MTH1187 family (TIGR00106; HMM-score: 31.3)
  • TheSEED  :
    • Cytoplasmic thiamin-binding component of thiamin ABC transporter, COG0011 family
  • PFAM:
    MTH1187-YkoF (CL0360) Thiamine_BP; Thiamine-binding protein (PF01910; HMM-score: 59.7)

Insert paragraph

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Insert paragraph

⊟Localization[edit | edit source]

  • ⊞PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • ⊞DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9979
    • Cytoplasmic Membrane Score: 0.0004
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0016
  • ⊞LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • ⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004718
    • TAT(Tat/SPI): 0.000076
    • LIPO(Sec/SPII): 0.000233
  • predicted transmembrane helices (TMHMM): 0

Insert paragraph

⊟Accession numbers[edit | edit source]

Insert paragraph

⊟Protein sequence[edit | edit source]

  • MKDTLMSIQIIPKTPNNDNVIPYVDEAIKIIDESGLHFRVGPLETTVQGNMNECLILIQSLNERMVELECPSIISQVKFYHVPDGITIETLTEKYDE

Insert paragraph

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2]
  • quantitative data / protein copy number per cell: 910 [3]
  • interaction partners:

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  3. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
Insert paragraph

⊟Expression & Regulation[edit | edit source]

Insert paragraph

⊟Operon[edit | edit source]

Insert paragraph

⊟Regulation[edit | edit source]

  • regulator:

Insert paragraph

⊟Transcription pattern[edit | edit source]

Insert paragraph

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

Insert paragraph

⊟Protein stability[edit | edit source]

  • half-life: 19.1 h [1]

  1. ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)
Insert paragraph

⊞Biological Material[edit | edit source]

This data comes from external databases and cannot be edited.

This data comes from external databases and cannot be edited.

This data comes from external databases and cannot be edited.

This data comes from external databases and cannot be edited.

This data comes from external databases and cannot be edited.

This data comes from external databases and cannot be edited.

This data comes from external databases and cannot be edited.

⊞Other Information[edit | edit source]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

Insert paragraph

⊟Relevant publications[edit | edit source]

Insert paragraph