Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2404 [new locus tag: SA_RS13755 ]
- pan locus tag?: SAUPAN006312000
- symbol: SA2404
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2404 [new locus tag: SA_RS13755 ]
- symbol: SA2404
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2693787..2693999
- length: 213
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1125333 NCBI
- RefSeq: NP_375730 NCBI
- BioCyc: see SA_RS13755
- MicrobesOnline: 104756 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAGCTTTTACGAATATATACAAACATTTAAAGATGATAAAACACCATTAGGCGAATTA
GCGATTTGGATTAAAGAAGATGATTCATTCCCAAAACAAGAGAAGCTAACAGAAAACATT
TTGTCTTATTTTCATCAAATGTCCAATATAGATCATGAGTTTTTAGAAATTGTAAAAAGA
TCACTTTCTCTGTATGATCAATTAAAATCGTAA60
120
180
213
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA2404 [new locus tag: SA_RS13755 ]
- symbol: SA2404
- description: hypothetical protein
- length: 70
- theoretical pI: 4.55171
- theoretical MW: 8436.49
- GRAVY: -0.584286
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSFYEYIQTFKDDKTPLGELAIWIKEDDSFPKQEKLTENILSYFHQMSNIDHEFLEIVKRSLSLYDQLKS
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available