Navigation

  • Main page
  • Downloads
  • Getting Started
  • Recent changes
  • Random page
  • What links here
  • Related changes
  • Special pages
  • Printable version
  • Permanent link
  • Page information

personal-loginout

  • Log in
  • Not logged in
  • Talk
  • Contributions
  • Create account

Search

?

Navigation menu

Namespaces
  • Page
  • Discussion
English
From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

Views
  • Read
  • Edit
  • History
  • Edit source

⊟Summary[edit | edit source]

Contents

  • 1 Summary
  • 2 Genome View
  • 3 Gene
    • 3.1 General
    • 3.2 Accession numbers
    • 3.3 Phenotype
    • 3.4 DNA sequence
  • 4 Protein
    • 4.1 General
    • 4.2 Function
    • 4.3 Structure, modifications & cofactors
    • 4.4 Localization
    • 4.5 Accession numbers
    • 4.6 Protein sequence
    • 4.7 Experimental data
  • 5 Expression & Regulation
    • 5.1 Operon
    • 5.2 Regulation
    • 5.3 Transcription pattern
    • 5.4 Protein synthesis (provided by Aureolib)
    • 5.5 Protein stability
  • 6 Biological Material
    • 6.1 Mutants
    • 6.2 Expression vector
    • 6.3 lacZ fusion
    • 6.4 GFP fusion
    • 6.5 two-hybrid system
    • 6.6 FLAG-tag construct
    • 6.7 Antibody
  • 7 Other Information
  • 8 Literature
    • 8.1 References
    • 8.2 Relevant publications
  • organism: Staphylococcus aureus N315
  • locus tag: SA0961 [new locus tag: SA_RS05445 ]
  • pan locus tag?: SAUPAN003339000
  • symbol: SA0961
  • pan gene symbol?: fpa
  • synonym: ylaN
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA0961 [new locus tag: SA_RS05445 ]
  • symbol: SA0961
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1088873..1089148
  • length: 276
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

  • Gene ID: 1123787 NCBI
  • RefSeq: NP_374230 NCBI
  • BioCyc: see SA_RS05445
  • MicrobesOnline: 103256 MicrobesOnline

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGGCGAAACAAGCAACAATGAAAAATGCAGCTTTGAAACAATTGACTAAAGATGCTGAT
    GAAATCTTGCATCTGATTAAAGTTCAACTAGATAATTTAACATTACCTTCATGCCCATTA
    TATGAAGAAGTACTAGATACACAAATGTTTGGACTTCAAAAAGAAGTTGATTTTGCTGTT
    AAATTAGGTTTAGTTGACCGCGAAGATGGCAAACAAATTATGTTACGTCTTGAGAAAGAA
    CTTTCAAAATTACATGAAGCTTTTACACTTGTTTAA
    60
    120
    180
    240
    276

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA0961 [new locus tag: SA_RS05445 ]
  • symbol: SA0961
  • description: hypothetical protein
  • length: 91
  • theoretical pI: 5.13718
  • theoretical MW: 10355.1
  • GRAVY: -0.124176

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • UPF0358 protein YlaN
  • ⊞PFAM:
    no clan defined DUF1507; Protein of unknown function (DUF1507) (PF07408; HMM-score: 124.8)
    and 2 more
    DUF2680; Protein of unknown function (DUF2680) (PF10925; HMM-score: 17.3)
    Nas2_N; Nas2 N_terminal domain (PF18265; HMM-score: 12.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • ⊞DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8031
    • Cytoplasmic Membrane Score: 0.0376
    • Cell wall & surface Score: 0.0015
    • Extracellular Score: 0.1577
  • ⊞LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • ⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.000996
    • TAT(Tat/SPI): 0.000153
    • LIPO(Sec/SPII): 0.000191
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI: 15926697 NCBI
  • RefSeq: NP_374230 NCBI
  • UniProt: Q7A668 UniProt

⊟Protein sequence[edit | edit source]

  • MAKQATMKNAALKQLTKDADEILHLIKVQLDNLTLPSCPLYEEVLDTQMFGLQKEVDFAVKLGLVDREDGKQIMLRLEKELSKLHEAFTLV

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

  • MicrobesOnline: no polycistronic organisation predicted

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

  • S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

  • Aureolib: no data available

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Ling Xu, Svetlana E Sedelnikova, Patrick J Baker, David W Rice
Cloning, purification and preliminary crystallographic analysis of a conserved hypothetical protein, SA0961 (YlaN), from Staphylococcus aureus.
Acta Crystallogr Sect F Struct Biol Cryst Commun: 2006, 62(Pt 8);778-80
[PubMed:16880555] [WorldCat.org] [DOI] (I p)

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SA0961&oldid=76736"
  • This page was last edited on 11 March 2016, at 00:04.
  • Privacy and Cookies
  • About AureoWiki
  • Imprint
We use Matomo for user statistics and cookies. Privacy and Cookies X
CancelTry again