Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0101
- pan locus tag?: SAUPAN000900000
- symbol: SA0101
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0101
- symbol: SA0101
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 115245..115415
- length: 171
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1122875 NCBI
- RefSeq: NP_373342 NCBI
- BioCyc:
- MicrobesOnline: 102368 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGATATGTTCACAAACTTTATTTCGTTATCCCACTCACATGATTTTTTTGATGAAACAT
AATTACATGATTGATTGCATCATTTTGTTAAACAATTTATTGCAAACCTGCCATTTCACA
CTGAAAATTTACATAATAAGTGACGATATTTTACAAGTCATATACAAATAA60
120
171
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0101
- symbol: SA0101
- description: hypothetical protein
- length: 56
- theoretical pI: 8.06787
- theoretical MW: 6782.22
- GRAVY: 0.617857
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MICSQTLFRYPTHMIFLMKHNYMIDCIILLNNLLQTCHFTLKIYIISDDILQVIYK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available