From AureoWiki
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS08335 [old locus tag: SACOL1635 ]
  • symbol: SACOL_RS08335
  • product: 50S ribosomal protein L11 methyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 1664357..1665295
  • length: 939
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (1664357..1665295) NCBI
  • BioCyc: SACOL_RS08335 BioCyc
  • MicrobesOnline: see SACOL1635

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGAACTGGACAGAGCTTTCAATTATTATTAATCATGAAGCAGTAGAATTGGCTACCAAT
    ATACTTGAAAATCATGGATCAAATGGTGTCGTGATAGAAGATTCAGATGGTTTAATTAAC
    CAACCAGAAGATAAATACGGTGAAATTTACGCTTTGAAAAAAGAGGATTATCCAGATAAG
    GGAGTAAGATTGAAAGCCTATTTTAATGAAATGACTTATGATGATAAGTTGCGACAGCAA
    ATTAAAGATGAGTTATTAAATTTAGATGAACTTGATCAACATAACGTTCAATTCAGTGAG
    CAAATTATTGCAGAGACGGATTGGGAAAATGAATGGAAAAACTATTTCCATCCATTCCGA
    GCGTCGAAGAAGTTCACAATAGTTCCTAGTTGGGAAACATATGCTAAAGAAGCGGATGAA
    GAGCTTTGCATTGAGCTCGACCCAGGTATGGCTTTTGGAACAGGTGATCATCCGACTACA
    AGTATGTGTTTGAAGGCAATAGAAACATATGTATTGCCACAGCATTCAGTAATTGATGTT
    GGTACTGGCTCAGGTATATTAAGTATTGCAAGTCATCTAATCGGTGTAAAACGTATTAAA
    GCGTTGGATATTGATGAAATGGCAGTGAGTGTAGCTAAAGAAAACTTCAGAAGAAATCAT
    TGTGAAACGTTAATTGAAGCTGTTCCAGGTAACTTATTGAAAGACGAAACAGAAAAATTT
    GATATTGTAATAGCAAATATTTTAGCGCATATTATTGATGAAATGATTGAAGATGCTTAT
    AATACTCTAAATGAAGGCGGTTATTTTATTACTTCTGGTATTATAAAAGAGAAGTATGAA
    GGTATACAGTCACATATGGAGCGTGTAGGTTTTAAAATTATTTCAGAACAACATGACAAC
    GGTTGGGTTTGTCTTGTTGGCCAGAAAGTGAGTGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    939

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS08335 [old locus tag: SACOL1635 ]
  • symbol: SACOL_RS08335
  • description: 50S ribosomal protein L11 methyltransferase
  • length: 312
  • theoretical pI: 4.36505
  • theoretical MW: 35454.7
  • GRAVY: -0.366987

Function[edit | edit source]

  • reaction:
    EC 2.1.1.-?  ExPASy
  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein L11 methyltransferase (TIGR00406; EC 2.1.1.-; HMM-score: 255.1)
    and 13 more
    Genetic information processing Protein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 45.4)
    Genetic information processing Protein fate Protein modification and repair methyltransferase, HemK family (TIGR00536; HMM-score: 39.6)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 3-demethylubiquinone-9 3-O-methyltransferase (TIGR01983; EC 2.1.1.64; HMM-score: 37.7)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 37.6)
    Unknown function Enzymes of unknown specificity putative methylase (TIGR00537; HMM-score: 36.7)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 32)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Chlorophyll and bacteriochlorphyll magnesium protoporphyrin O-methyltransferase (TIGR02021; EC 2.1.1.11; HMM-score: 30.4)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Biotin malonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 24.5)
    methyltransferase, ATP-grasp peptide maturase system (TIGR04188; HMM-score: 18.4)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific (TIGR03704; EC 2.1.1.-; HMM-score: 17)
    Genetic information processing Protein synthesis tRNA and rRNA base modification 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG (TIGR00138; EC 2.1.1.170; HMM-score: 16.2)
    Genetic information processing Protein synthesis tRNA and rRNA base modification ribosomal RNA small subunit methyltransferase A (TIGR00755; EC 2.1.1.182; HMM-score: 15.5)
    Hypothetical proteins Conserved putative methyltransferase, TIGR01177 family (TIGR01177; HMM-score: 14.6)
  • TheSEED: see SACOL1635
  • PFAM:
    NADP_Rossmann (CL0063) PrmA; Ribosomal protein L11 methyltransferase (PrmA) (PF06325; HMM-score: 362.6)
    and 15 more
    MTS; Methyltransferase small domain (PF05175; HMM-score: 56.8)
    Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 39.6)
    Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 35.6)
    Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 31.8)
    Methyltransf_18; Methyltransferase domain (PF12847; HMM-score: 31.4)
    Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 28.5)
    TRM5-TYW2_MTfase; TRM5/TYW2 methyltransferase domain (PF02475; HMM-score: 21.9)
    Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 20.9)
    PCMT; Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (PF01135; HMM-score: 18.7)
    Spermine_synth; Spermine/spermidine synthase domain (PF01564; HMM-score: 18.4)
    Cons_hypoth95; Conserved hypothetical protein 95 (PF03602; HMM-score: 17.6)
    UPF0020; RMKL-like, methyltransferase domain (PF01170; HMM-score: 13)
    GidB; rRNA small subunit methyltransferase G (PF02527; HMM-score: 13)
    TRM; N2,N2-dimethylguanosine tRNA methyltransferase (PF02005; HMM-score: 12.2)
    RrnaAD; Ribosomal RNA adenine dimethylase (PF00398; HMM-score: 11.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9979
    • Cytoplasmic Membrane Score: 0.0005
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0014
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008118
    • TAT(Tat/SPI): 0.000273
    • LIPO(Sec/SPII): 0.001161
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNWTELSIIINHEAVELATNILENHGSNGVVIEDSDGLINQPEDKYGEIYALKKEDYPDKGVRLKAYFNEMTYDDKLRQQIKDELLNLDELDQHNVQFSEQIIAETDWENEWKNYFHPFRASKKFTIVPSWETYAKEADEELCIELDPGMAFGTGDHPTTSMCLKAIETYVLPQHSVIDVGTGSGILSIASHLIGVKRIKALDIDEMAVSVAKENFRRNHCETLIEAVPGNLLKDETEKFDIVIANILAHIIDEMIEDAYNTLNEGGYFITSGIIKEKYEGIQSHMERVGFKIISEQHDNGWVCLVGQKVSE

Experimental data[edit | edit source]

  • experimentally validated: see SACOL1635
  • protein localization: see SACOL1635
  • quantitative data / protein copy number per cell: see SACOL1635
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • data available for JSNZ

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]