PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 03-AUG-2016

Views

More

• Read
• Edit
• History
• Edit source

⊟Summary

• organism: Staphylococcus aureus NCTC8325
locus tag: SAOUHSC_00136
pan locus tag^?: SAUPAN001010000
symbol: SAOUHSC_00136
pan gene symbol^?: ssuB
• synonym:
• product: hypothetical protein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SAOUHSC_00136
• symbol: SAOUHSC_00136
• product: hypothetical protein
• replicon: chromosome
• strand: +
• coordinates: 141658..142398
• length: 741
• essential: no DEG other strains

⊟Accession numbers

• Gene ID: 3919845 NCBI
• RefSeq: YP_498736 NCBI
• BioCyc: G1I0R-127 BioCyc
• MicrobesOnline: 1288630 MicrobesOnline

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  301
  361
  421
  481
  541
  601
  661
  721
  
  ATGATTAAAATTCAACAATTACAACATCACTTTGGATCACATAAAGTAATTCATAACTTT
  AATTTGGACATTAGCAAGGGAGAAATAGTCACTTTCATAGGGAAAAGTGGTTGCGGAAAG
  TCTACTTTACTCAATATTATCGGTGGATTTATTCATCCATCGTCTGGTCGTGTCATTATT
  GATAACGAAATTAAACAACAGCCATCTCCAGATTGTTTAATGCTATTTCAACATCATAAT
  TTGCTGCCATGGAAAACGATTAATGACAACATTAGGATTGGATTACAACAGAAAATTAGT
  GATGAAGAGATTAACGCACAGCTTAAATTAGTTGATTTAGAAGACAGGGGAAAGCATTTT
  CCCGAGCAACTGTCCGGGGGTATGAAACAACGTGTGGCACTATGTCGAGCGCATGTGCAT
  AAGCCTAACGTTATATTGATGGATGAGCCATTAGGTGCATTAGATGCATTTACACGTTAT
  AAACTTCAGGATCAACTAGTGCAACTAAAACATAAAACGCAATCAACTATTATTTTAGTG
  ACGCATGACATTGATGAAGCTATTTATCTTTCCGACCGCATTGTTCTGTTAGGTGAAGGG
  TGCAATATTATTTCTCAATATGAAATTACAGCATCACATCCACGCAGTCGTAATGATAGC
  CACCTACTTAAGATTCGTAATGAAATTATGGAAACATTTGCATTGAATCATCATCAAGTT
  GAACCTGAATATTATTTATAA
  60
  120
  180
  240
  300
  360
  420
  480
  540
  600
  660
  720
  741
  

⊟Protein

⊟General

• locus tag: SAOUHSC_00136
• symbol: SAOUHSC_00136
• description: hypothetical protein
• length: 246
• theoretical pI: 7.28135
• theoretical MW: 28095.2
• GRAVY: -0.295935

⊟Function

• ⊞TIGRFAM:
  Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 213.2)
  Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 213.2)
  Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 195)
  Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 192.2)
  2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 173)
  and 70 more
  Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 168.6)
  Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 168.1)
  Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 166.5)
  Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 148.3)
  ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 145)
  Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 142.7)
  Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 142.7)
  Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 132)
  Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 129.1)
  Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 126.3)
  Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 126.2)
  Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 126)
  Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 125.1)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 121.4)
  Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 116.1)
  thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 115.6)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 115)
  ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 114.7)
  D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 112.8)
  Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 112.1)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 112.1)
  lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 111)
  thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 108.8)
  Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 107.3)
  Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 96.8)
  Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 93.6)
  Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 93.6)
  Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 93.2)
  Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 92.1)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 91.2)
  Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 91.2)
  Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 91.1)
  Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 91.1)
  Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 91.1)
  gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 91)
  Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 90.5)
  Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 90.3)
  Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 90.3)
  Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 88.3)
  Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 88.3)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 87.9)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 87.5)
  Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 87.5)
  Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 87.5)
  ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 84.9)
  proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 84.2)
  Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 83.6)
  Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 83.1)
  Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 82.6)
  Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 82.6)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 81.3)
  ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 78.6)
  Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 75.5)
  Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 73.5)
  phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 70.8)
  Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 70.4)
  Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 70.4)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 66)
  Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 59.6)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 58.9)
  Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 54.3)
  Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 51.9)
  Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 47.9)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 46.5)
  Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 31.2)
  Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 28.6)
  Genetic information processing Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 15.4)
  Genetic information processing DNA metabolism Restriction/modification DNA sulfur modification protein DndD (TIGR03185; HMM-score: 14)
  Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 13)
  Genetic information processing Protein synthesis Other ribosome biogenesis GTP-binding protein YsxC (TIGR03598; HMM-score: 12.7)
• TheSEED  :
  • ABC transporter ATP-binding subunit
• ⊞PFAM:
  P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 113.4)
  and 14 more
  AAA_15; AAA ATPase domain (PF13175; HMM-score: 22.5)
  AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 22.1)
  RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 21.6)
  ABC_ATPase; P-loop domain (PF09818; HMM-score: 17.4)
  AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 17.2)
  AAA_23; AAA domain (PF13476; HMM-score: 16.2)
  SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 15.7)
  AAA_22; AAA domain (PF13401; HMM-score: 14.4)
  AAA_25; AAA domain (PF13481; HMM-score: 14.2)
  AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 13.8)
  MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13.7)
  nSTAND1; Novel STAND NTPase 1 (PF20703; HMM-score: 13.1)
  Dynamin_N; Dynamin family (PF00350; HMM-score: 11.6)
  NB-ARC; NB-ARC domain (PF00931; HMM-score: 11.4)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• ⊞PSORTb: Cytoplasmic Membrane
  • Cytoplasmic Score: 1.05
  • Cytoplasmic Membrane Score: 8.78
  • Cellwall Score: 0.08
  • Extracellular Score: 0.09
  • Internal Helices: 0
• ⊞DeepLocPro: Cytoplasmic Membrane
  • Cytoplasmic Score: 0.1679
  • Cytoplasmic Membrane Score: 0.8257
  • Cell wall & surface Score: 0.0001
  • Extracellular Score: 0.0063
• ⊞LocateP: Intracellular
  • Prediction by SwissProt Classification: Cytoplasmic
  • Pathway Prediction: No pathway
  • Intracellular possibility: 1
  • Signal peptide possibility: -1
  • N-terminally Anchored Score: -1
  • Predicted Cleavage Site: No CleavageSite
• ⊞SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.028611
  • TAT(Tat/SPI): 0.000802
  • LIPO(Sec/SPII): 0.005202
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 88193949 NCBI
• RefSeq: YP_498736 NCBI
• UniProt: Q2G1I6 UniProt
• STRING: 93061.SAOUHSC_00136 STRING

⊟Protein sequence

• MIKIQQLQHHFGSHKVIHNFNLDISKGEIVTFIGKSGCGKSTLLNIIGGFIHPSSGRVIIDNEIKQQPSPDCLMLFQHHNLLPWKTINDNIRIGLQQKISDEEINAQLKLVDLEDRGKHFPEQLSGGMKQRVALCRAHVHKPNVILMDEPLGALDAFTRYKLQDQLVQLKHKTQSTIILVTHDIDEAIYLSDRIVLLGEGCNIISQYEITASHPRSRNDSHLLKIRNEIMETFALNHHQVEPEYYL

⊟Experimental data

• experimentally validated: PeptideAtlas
• protein localization:
• quantitative data / protein copy number per cell:
• ⊟interaction partners:

  SAOUHSC_00729		ABC transporter ATP-binding protein   (data from MRSA252)
  SAOUHSC_01040		pyruvate dehydrogenase complex, E1 component subunit alpha   (data from MRSA252)
  SAOUHSC_01042		branched-chain alpha-keto acid dehydrogenase subunit E2   (data from MRSA252)
  SAOUHSC_01043		dihydrolipoamide dehydrogenase   (data from MRSA252)
  SAOUHSC_01806		pyruvate kinase   (data from MRSA252)
  SAOUHSC_02965		carbamate kinase   (data from MRSA252)

⊟Expression & Regulation

⊟Operon

• MicrobesOnline: SAOUHSC_00136 > SAOUHSC_00137 > SAOUHSC_00138 > SAOUHSC_00139
  predicted SigA promoter  : SAOUHSC_00135 > S44 > SAOUHSC_00136 > SAOUHSC_00137 > SAOUHSC_00138 > SAOUHSC_00139 > S45 > SAOUHSC_00141

⊟Regulation

• ⊞regulator: CymR* (repression) regulon

  CymR*

  (TF)

  important in Cysteine metabolism; RegPrecise

⊟Transcription pattern

• S.aureus Expression Data Browser:   
  
  ⊟Multi-gene expression profiles

  Compare with:

  Conditions

  Select all flucRPMI-exp RPMI-exp-A2 vancRPMI-exp RPMI-exp-A1 TSB-exp-A TSB-exp-C ciproTSB-exp T/SmxTSB-exp clindTSB-exp lineTSB-exp eryTSB-exp TSB-exp-B3 flucTSB-exp TSB-exp-B2 vancTSB-exp TSB-exp-B1 RPMI/FCS-exp colist-exp intTHP1-2h intTHP1-6h intS9-6h intS9-2h TSB-t2-C TSB-t4-C flucTSB-t4 TSB-t2-B1 TSB-t4-B1 CDM-t2 CDM-t4 T/SmxTSB-t4 TSB-t4-B3 lineTSB-t4 TSB-t4-B2 vancTSB-t4 eryTSB-t4 clindTSB-t4 ciproTSB-t4 pMEM-t2-C1 pMEM-t4-C1 CO2-6h CO2-2h anaer-2h nonad50-1h CO2-1h nonad25-1h pMEM-exp-C2 pMEM-exp-C1 CDM-exp plasma-t4 vancRPMI-t4 flucRPMI-t4 RPMI-t4-A2 RPMI-t2-A1 plasma-exp

  
  
  Click on any data point to display a description of the corresponding condition!

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊞Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊞Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications