From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2024 [new locus tag: SACOL_RS10570 ]
  • pan locus tag?: SAUPAN005276000
  • symbol: agrD
  • pan gene symbol?: agrD
  • synonym:
  • product: accessory gene regulator protein D

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2024 [new locus tag: SACOL_RS10570 ]
  • symbol: agrD
  • product: accessory gene regulator protein D
  • replicon: chromosome
  • strand: +
  • coordinates: 2083704..2083844
  • length: 141
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGAATACATTATTTAACTTATTTTTTGATTTTATTACTGGGATTTTAAAAAACATTGGT
    AACATCGCAGCTTATAGTACTTGTGACTTCATAATGGATGAAGTTGAAGTACCAAAAGAA
    TTAACACAATTACACGAATAA
    60
    120
    141

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL2024 [new locus tag: SACOL_RS10570 ]
  • symbol: AgrD
  • description: accessory gene regulator protein D
  • length: 46
  • theoretical pI: 3.96381
  • theoretical MW: 5297.07
  • GRAVY: 0.293478

⊟Function[edit | edit source]

  • TIGRFAM:
    cyclic lactone autoinducer peptide (TIGR04223; HMM-score: 33.2)
  • TheSEED  :
    • Accessory gene regulator D (pheromone precursor, type III)
  • PFAM:
    no clan defined AgrD; Staphylococcal AgrD protein (PF05931; HMM-score: 112.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • ⊞DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.02
    • Cytoplasmic Membrane Score: 0.1988
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.7811
  • ⊞LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • ⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.09954
    • TAT(Tat/SPI): 0.007564
    • LIPO(Sec/SPII): 0.117094
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MNTLFNLFFDFITGILKNIGNIAAYSTCDFIMDEVEVPKELTQLHE

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • ⊞regulators: AgrA (activation) regulon, CodY (repression) regulon

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SACOL2024&oldid=80837"