Navigation

  • Main page
  • Downloads
  • Getting Started
  • Recent changes
  • Random page
  • What links here
  • Related changes
  • Special pages
  • Printable version
  • Permanent link
  • Page information

personal-loginout

  • Log in
  • Not logged in
  • Talk
  • Contributions
  • Create account

Search

?

Navigation menu

Namespaces
  • Page
  • Discussion
English
From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

Views
  • Read
  • Edit
  • History
  • Edit source

⊟Summary[edit | edit source]

Contents

  • 1 Summary
  • 2 Genome View
  • 3 Gene
    • 3.1 General
    • 3.2 Accession numbers
    • 3.3 Phenotype
    • 3.4 DNA sequence
  • 4 Protein
    • 4.1 General
    • 4.2 Function
    • 4.3 Structure, modifications & cofactors
    • 4.4 Localization
    • 4.5 Accession numbers
    • 4.6 Protein sequence
    • 4.7 Experimental data
  • 5 Expression & Regulation
    • 5.1 Operon
    • 5.2 Regulation
    • 5.3 Transcription pattern
    • 5.4 Protein synthesis (provided by Aureolib)
    • 5.5 Protein stability
  • 6 Biological Material
    • 6.1 Mutants
    • 6.2 Expression vector
    • 6.3 lacZ fusion
    • 6.4 GFP fusion
    • 6.5 two-hybrid system
    • 6.6 FLAG-tag construct
    • 6.7 Antibody
  • 7 Other Information
  • 8 Literature
    • 8.1 References
    • 8.2 Relevant publications
  • organism: Staphylococcus aureus N315
  • locus tag: SA0759 [new locus tag: SA_RS04325 ]
  • pan locus tag?: SAUPAN002820000
  • symbol: SA0759
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA0759 [new locus tag: SA_RS04325 ]
  • symbol: SA0759
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 865213..865569
  • length: 357
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

  • Gene ID: 1123572 NCBI
  • RefSeq: NP_374018 NCBI
  • BioCyc: see SA_RS04325
  • MicrobesOnline: 103044 MicrobesOnline

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGATTAAATTTTACCAATATAAGAATTGTACAACTTGTAAAAAGGCAGCAAAGTTTTTA
    GATGAATATGGCGTAAGTTATGAACCAATTGATATCGTTCAACATACACCTACAATAAAT
    GAATTTAAAACAATAATTGCAAATACAGGCGTAGAAATTAATAAATTGTTTAATACACAC
    GGTGCGAAATATCGTGAGCTTGATTTGAAAAATAAATTACAAACTTTATCAGATGATGAA
    AAGTTAGAGTTGTTATCATCTGATGGTATGTTAGTAAAGCGTCCTCTAGCAGTAATGGGC
    GATAAGATAACATTAGGATTTAAAGAAGATCAATATAAAGAGACTTGGTTAGCGTAA
    60
    120
    180
    240
    300
    357

⊟Protein[edit | edit source]

  • 2M46
    PDB
Protein Data Bank: 2M46

⊟General[edit | edit source]

  • locus tag: SA0759 [new locus tag: SA_RS04325 ]
  • symbol: SA0759
  • description: hypothetical protein
  • length: 118
  • theoretical pI: 7.40662
  • theoretical MW: 13599.6
  • GRAVY: -0.445763

⊟Function[edit | edit source]

  • ⊞TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, Spx/MgsR family (TIGR01617; HMM-score: 155)
    and 7 more
    glutaredoxin-like protein, YruB-family (TIGR02196; HMM-score: 40.2)
    Cellular processes Cellular processes Detoxification arsenate reductase (glutaredoxin) (TIGR00014; EC 1.20.4.1; HMM-score: 39.4)
    glutaredoxin-like protein NrdH (TIGR02194; HMM-score: 32.5)
    Unknown function General nitrogenase-associated protein (TIGR01616; HMM-score: 30.5)
    glutaredoxin-like protein (TIGR02200; HMM-score: 24.3)
    Metabolism Energy metabolism Electron transport glutaredoxin 3 (TIGR02181; HMM-score: 22.5)
    glutaredoxin-family domain (TIGR02190; HMM-score: 12.7)
  • ⊞TheSEED  :
    • Uncharacterized Spx/MgsR-like protein YusI
    Respiration Electron accepting reactions Anaerobic respiratory reductases  Arsenate reductase (EC 1.20.4.1)
    and 1 more
    Virulence, Disease and Defense Resistance to antibiotics and toxic compounds Arsenic resistance  Arsenate reductase (EC 1.20.4.1)
  • ⊞PFAM:
    Thioredoxin (CL0172) ArsC; ArsC family (PF03960; HMM-score: 72.9)
    and 4 more
    Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 32.7)
    no clan defined IMPa_helical; Immunomodulating metalloprotease helical domain (PF18642; HMM-score: 15.2)
    RNase_3_N; Ribonuclease III N-terminal domain (PF18497; HMM-score: 14.2)
    Thioredoxin (CL0172) Glrx-like; Glutaredoxin-like domain (DUF836) (PF05768; HMM-score: 12.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • ⊞DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9869
    • Cytoplasmic Membrane Score: 0.0014
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0114
  • ⊞LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • ⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006247
    • TAT(Tat/SPI): 0.000081
    • LIPO(Sec/SPII): 0.001464
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI: 15926485 NCBI
  • RefSeq: NP_374018 NCBI
  • UniProt: A0A0H3JM15 UniProt

⊟Protein sequence[edit | edit source]

  • MIKFYQYKNCTTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFNTHGAKYRELDLKNKLQTLSDDEKLELLSSDGMLVKRPLAVMGDKITLGFKEDQYKETWLA

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

  • MicrobesOnline: no polycistronic organisation predicted

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

  • S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

  • Aureolib: no data available

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SA0759&oldid=71386"
  • This page was last edited on 10 March 2016, at 21:10.
  • Privacy and Cookies
  • About AureoWiki
  • Imprint
We use Matomo for user statistics and cookies. Privacy and Cookies X
CancelTry again