From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SAS066 [new locus tag: SA_RS10575 ]
  • pan locus tag?: SAUPAN005276000
  • symbol: agrD
  • pan gene symbol?: agrD
  • synonym:
  • product: AgrD protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAS066 [new locus tag: SA_RS10575 ]
  • symbol: agrD
  • product: AgrD protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2080012..2080155
  • length: 144
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGAATACACTTGTTAATATGTTTTTTGATTTTATAATTAAATTAGCTAAAGCAATCGGA
    ATTGTCGGTGGCGTAAACGCTTGCAGCAGTTTATTTGATGAACCTAAAGTACCCGCTGAA
    TTAACGAATTTATACGACAAATAG
    60
    120
    144

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAS066 [new locus tag: SA_RS10575 ]
  • symbol: AgrD
  • description: AgrD protein
  • length: 47
  • theoretical pI: 4.63622
  • theoretical MW: 5149.04
  • GRAVY: 0.482979

⊟Function[edit | edit source]

  • TIGRFAM:
    cyclic lactone autoinducer peptide (TIGR04223; HMM-score: 35.2)
  • TheSEED  :
    • Accessory gene regulator D (pheromone precursor, type III)
  • PFAM:
    no clan defined AgrD; Staphylococcal AgrD protein (PF05931; HMM-score: 56.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • ⊞DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.0012
    • Cytoplasmic Membrane Score: 0.3976
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.6011
  • ⊞LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 0.67
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • ⊞SignalP: Signal peptide LIPO(Sec/SPII) length 27 aa
    • SP(Sec/SPI): 0.042942
    • TAT(Tat/SPI): 0.024222
    • LIPO(Sec/SPII): 0.877376
    • Cleavage Site: CS pos: 27-28. VNA-CS. Pr: 0.8875
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MNTLVNMFFDFIIKLAKAIGIVGGVNACSSLFDEPKVPAELTNLYDK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • ⊞regulators: AgrA (activation) regulon, CodY (repression) regulon

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SAS066&oldid=85637"