From AureoWiki
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS07480 [old locus tag: SACOL1466 ]
  • symbol: SACOL_RS07480
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1477460..1477711
  • length: 252
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (1477460..1477711) NCBI
  • BioCyc: SACOL_RS07480 BioCyc
  • MicrobesOnline: see SACOL1466

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAAATTATATCTATATCAGAAACACCGAACCACAACACAATGAAGATTACACTTAGT
    GAAAGCAGAGAAGGTATGACATCAGATACGTATACTAAAGTTGATGATTCACAGCCAGCA
    TTTATTAATGACATCTTAAAGGTTGAAGGCGTTAAATCAATTTTCCATGTTATGGACTTT
    ATTTCAGTAGATAAAGAAAATGACGCAAATTGGGAAACAGTATTGCCAAAAGTAGAGGCT
    GTATTCGAATAA
    60
    120
    180
    240
    252

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS07480 [old locus tag: SACOL1466 ]
  • symbol: SACOL_RS07480
  • description: hypothetical protein
  • length: 83
  • theoretical pI: 4.33059
  • theoretical MW: 9406.57
  • GRAVY: -0.308434

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SACOL1466
  • PFAM:
    Arg_repressor_C (CL0738) Nfu_N; Scaffold protein Nfu/NifU N terminal (PF08712; HMM-score: 67.2)
    and 1 more
    no clan defined DUF7056; Domain of unknown function (DUF7056) (PF23158; HMM-score: 12.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9903
    • Cytoplasmic Membrane Score: 0.0017
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0079
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005499
    • TAT(Tat/SPI): 0.000304
    • LIPO(Sec/SPII): 0.00068
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQPAFINDILKVEGVKSIFHVMDFISVDKENDANWETVLPKVEAVFE

Experimental data[edit | edit source]

  • experimentally validated: see SACOL1466
  • protein localization: see SACOL1466
  • quantitative data / protein copy number per cell: see SACOL1466
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]