Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SAS065 [new locus tag: SA_RS10565 ]
- pan locus tag?: SAUPAN005274000
- symbol: hld
- pan gene symbol?: hld
- synonym:
- product: delta-hemolysin
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAS065 [new locus tag: SA_RS10565 ]
- symbol: hld
- product: delta-hemolysin
- replicon: chromosome
- strand: -
- coordinates: 2079076..2079210
- length: 135
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1124734 NCBI
- RefSeq: NP_375143 NCBI
- BioCyc: see SA_RS10565
- MicrobesOnline: 104169 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAGTTGTTTAATTTTAAGAATTTTTATCTTAATTAAGGAAGGAGTGATTTCAATGGCA
CAAGATATCATTTCAACAATCGGTGACTTAGTAAAATGGATTATCGACACAGTGAACAAA
TTCACTAAAAAATAA60
120
135
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAS065 [new locus tag: SA_RS10565 ]
- symbol: Hld
- description: delta-hemolysin
- length: 44
- theoretical pI: 9.46068
- theoretical MW: 5009.12
- GRAVY: 0.802273
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- hypothetical protein
- ⊞PFAM: no clan defined Delta_lysin; Delta lysin family (PF05372; HMM-score: 71.9)and 1 more
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSCLILRIFILIKEGVISMAQDIISTIGDLVKWIIDTVNKFTKK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available