Navigation

  • Main page
  • Downloads
  • Getting Started
  • Recent changes
  • Random page
  • What links here
  • Related changes
  • Special pages
  • Printable version
  • Permanent link
  • Page information

personal-loginout

  • Log in
  • Not logged in
  • Talk
  • Contributions
  • Create account

Search

?

Navigation menu

Namespaces
  • Page
  • Discussion
English
From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Views
  • Read
  • Edit
  • History
  • Edit source

⊟Summary[edit | edit source]

Contents

  • 1 Summary
  • 2 Genome View
  • 3 Gene
    • 3.1 General
    • 3.2 Accession numbers
    • 3.3 Phenotype
    • 3.4 DNA sequence
  • 4 Protein
    • 4.1 General
    • 4.2 Function
    • 4.3 Structure, modifications & cofactors
    • 4.4 Localization
    • 4.5 Accession numbers
    • 4.6 Protein sequence
    • 4.7 Experimental data
  • 5 Expression & Regulation
    • 5.1 Operon
    • 5.2 Regulation
    • 5.3 Transcription pattern
    • 5.4 Protein synthesis (provided by Aureolib)
    • 5.5 Protein stability
  • 6 Biological Material
    • 6.1 Mutants
    • 6.2 Expression vector
    • 6.3 lacZ fusion
    • 6.4 GFP fusion
    • 6.5 two-hybrid system
    • 6.6 FLAG-tag construct
    • 6.7 Antibody
  • 7 Other Information
  • 8 Literature
    • 8.1 References
    • 8.2 Relevant publications
  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS09735 [old locus tag: SACOL1890 ]
  • pan locus tag?: SAUPAN004759000
  • symbol: SACOL_RS09735
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS09735 [old locus tag: SACOL1890 ]
  • symbol: SACOL_RS09735
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1945497..1945607
  • length: 111
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002951 (1945497..1945607) NCBI
  • BioCyc: SACOL_RS09735 BioCyc
  • MicrobesOnline: see SACOL1890

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    ATGATTAAATGTCAGTTTTATGACATTTATTTATTGAAAATACGAACGAATGAGCGATAT
    GATAATATAGATAAGAATGATTTTAATTTAGGAGGCCTTTATGGTGCATAA
    60
    111

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL_RS09735 [old locus tag: SACOL1890 ]
  • symbol: SACOL_RS09735
  • description: hypothetical protein
  • length: 36
  • theoretical pI: 6.45259
  • theoretical MW: 4318.91
  • GRAVY: -0.494444

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞PSORTb: Extracellular
    • Cytoplasmic Score: 0.24
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.8
    • Extracellular Score: 8.91
    • Internal Helices: 0
  • ⊞DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7524
    • Cytoplasmic Membrane Score: 0.0003
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.2473
  • LocateP:
  • ⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.146417
    • TAT(Tat/SPI): 0.006198
    • LIPO(Sec/SPII): 0.026158
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI: 487705922 NCBI
  • RefSeq: WP_001790154 NCBI
  • UniProt: see SACOL1890

⊟Protein sequence[edit | edit source]

  • MIKCQFYDIYLLKIRTNERYDNIDKNDFNLGGLYGA

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

  • S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

  • Aureolib: no data available

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SACOL_RS09735&oldid=99866"
  • This page was last edited on 11 March 2016, at 12:47.
  • Privacy and Cookies
  • About AureoWiki
  • Imprint
We use Matomo for user statistics and cookies. Privacy and Cookies X
CancelTry again