Navigation

  • Main page
  • Downloads
  • Getting Started
  • Recent changes
  • Random page
  • What links here
  • Related changes
  • Special pages
  • Printable version
  • Permanent link
  • Page information

personal-loginout

  • Log in
  • Not logged in
  • Talk
  • Contributions
  • Create account

Search

?

Navigation menu

Namespaces
  • Page
  • Discussion
English
From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159JSNZLGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Views
  • Read
  • Edit
  • History
  • Edit source

⊟Summary[edit | edit source]

Contents

  • 1 Summary
  • 2 Genome View
  • 3 Gene
    • 3.1 General
    • 3.2 Accession numbers
    • 3.3 Phenotype
    • 3.4 DNA sequence
  • 4 Protein
    • 4.1 General
    • 4.2 Function
    • 4.3 Structure, modifications & cofactors
    • 4.4 Localization
    • 4.5 Accession numbers
    • 4.6 Protein sequence
    • 4.7 Experimental data
  • 5 Expression & Regulation
    • 5.1 Operon
    • 5.2 Regulation
    • 5.3 Transcription pattern
    • 5.4 Protein synthesis (provided by Aureolib)
    • 5.5 Protein stability
  • 6 Biological Material
    • 6.1 Mutants
    • 6.2 Expression vector
    • 6.3 lacZ fusion
    • 6.4 GFP fusion
    • 6.5 two-hybrid system
    • 6.6 FLAG-tag construct
    • 6.7 Antibody
  • 7 Other Information
  • 8 Literature
    • 8.1 References
    • 8.2 Relevant publications
  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1024 [new locus tag: SACOL_RS05225 ]
  • pan locus tag?: SAUPAN003197000
  • symbol: SACOL1024
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1024 [new locus tag: SACOL_RS05225 ]
  • symbol: SACOL1024
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1033567..1033818
  • length: 252
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Gene ID: 3236161 NCBI
  • RefSeq: YP_185890 NCBI
  • BioCyc: see SACOL_RS05225
  • MicrobesOnline: 912492 MicrobesOnline

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    TTGATTAATAAAAGATTTATTGATGAAGGTAAAACTATTGATGTTTATTTATTCGAAGCA
    TTAAATAACCAGATAATCATTGCTATACCAGATTGGTTTTGGTCATATCAGATGGCAATG
    ACATTAGATGAAGAAACTTGTTTTGAAGCAATACTCATGCAATTGTTTGTTTTTAAAGAA
    GAGGAAGAGGCAGAATCGATTGCATCACAACTAACAGATTGGATAGAAACATATAAAAAG
    GAGAAAGACTAA
    60
    120
    180
    240
    252

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1024 [new locus tag: SACOL_RS05225 ]
  • symbol: SACOL1024
  • description: hypothetical protein
  • length: 83
  • theoretical pI: 3.87053
  • theoretical MW: 9953.29
  • GRAVY: -0.192771

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108336: hypothetical protein
  • PFAM:
    no clan defined YueH; YueH-like protein (PF14166; HMM-score: 103.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • ⊞PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • ⊞DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7074
    • Cytoplasmic Membrane Score: 0.0859
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.2065
  • ⊞LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • ⊞SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001216
    • TAT(Tat/SPI): 0.000099
    • LIPO(Sec/SPII): 0.00021
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI: 57650210 NCBI
  • RefSeq: YP_185890 NCBI
  • UniProt: A0A0H2WW17 UniProt

⊟Protein sequence[edit | edit source]

  • MINKRFIDEGKTIDVYLFEALNNQIIIAIPDWFWSYQMAMTLDEETCFEAILMQLFVFKEEEEAESIASQLTDWIETYKKEKD

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

  • MicrobesOnline: murE > SACOL1024 > prfC

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

  • S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

  • Aureolib: no data available

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊞Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊞Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://fungenwikiserver.biologie.uni-greifswald.de/aureowiki/index.php?title=SACOL1024&oldid=98887"
  • This page was last edited on 11 March 2016, at 12:16.
  • Privacy and Cookies
  • About AureoWiki
  • Imprint
We use Matomo for user statistics and cookies. Privacy and Cookies X
CancelTry again