Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0844 [new locus tag: SACOL_RS04340 ]
- pan locus tag?: SAUPAN002712000
- symbol: secG
- pan gene symbol?: secG
- synonym:
- product: preprotein translocase subunit SecG
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0844 [new locus tag: SACOL_RS04340 ]
- symbol: secG
- product: preprotein translocase subunit SecG
- replicon: chromosome
- strand: +
- coordinates: 871883..872116
- length: 234
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238677 NCBI
- RefSeq: YP_185718 NCBI
- BioCyc: see SACOL_RS04340
- MicrobesOnline: 912317 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGCATACATTTTTAATCGTATTATTAATCATTGATTGTATTGCATTAATAACTGTTGTA
CTACTCCAAGAAGGTAAAAGCAGTGGACTTTCAGGTGCCATCAGTGGTGGTGCTGAGCAG
TTATTCGGTAAACAAAAACAACGTGGCGTCGATTTATTCTTAAATAGATTAACAATTATT
TTATCAATATTATTTTTTGTACTTATGATTTGCATAAGTTATCTTGGTATGTAA60
120
180
234
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0844 [new locus tag: SACOL_RS04340 ]
- symbol: SecG
- description: preprotein translocase subunit SecG
- length: 77
- theoretical pI: 8.22953
- theoretical MW: 8399.2
- GRAVY: 1.17922
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking preprotein translocase, SecG subunit (TIGR00810; HMM-score: 82.4)
- TheSEED :
- Protein translocase membrane subunit SecG
- ⊞PFAM: no clan defined SecG; Preprotein translocase SecG subunit (PF03840; HMM-score: 84.1)and 1 more
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTIILSILFFVLMICISYLGM
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Integral membrane [1] [2]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊞Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊞Other Information[edit | edit source]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)