From AureoWiki
Revision as of 07:02, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0580 [new locus tag: SA_RS03345 ]
  • symbol: SA0580
  • product: monovalent cation/H+ antiporter subunit C
  • replicon: chromosome
  • strand: +
  • coordinates: 672786..673130
  • length: 345
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGAATTTAATATTATTACTAGTTATAGGATTTTTAGTGTTTATAGGAACATATATGATT
    TTATCAATCAATTTAATTCGTATTGTAATCGGAATTTCAATATATACTCATGCTGGTAAT
    CTCATTATTATGAGTATGGGAACGTATGGTTCTAGTAGATCAGAACCATTAATAACTGGT
    GGAAACCAATTGTTTGTTGATCCCTTGTTACAAGCTATTGTACTAACTGCAATAGTTATA
    GGGTTTGGGATGACTGCGTTTTTACTTGTACTTGTTTATAGAACTTATAAAGTAACAAAA
    GAAGATGAAATTGAAGGCCTAAGGGGGGAAGATGATGCTAAGTAA
    60
    120
    180
    240
    300
    345

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA0580 [new locus tag: SA_RS03345 ]
  • symbol: SA0580
  • description: monovalent cation/H+ antiporter subunit C
  • length: 114
  • theoretical pI: 4.93178
  • theoretical MW: 12495.9
  • GRAVY: 0.886842

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Cations and iron carrying compounds multicomponent Na+:H+ antiporter, MnhC subunit (TIGR00941; HMM-score: 99.1)
  • TheSEED  :
    • Na(+) H(+) antiporter subunit C (TC 2.A.63.1.3)
    Membrane Transport Uni- Sym- and Antiporters Sodium Hydrogen Antiporter  Na(+) H(+) antiporter subunit C (TC 2.A.63.1.3)
  • PFAM:
    no clan defined Oxidored_q2; NADH-ubiquinone/plastoquinone oxidoreductase chain 4L (PF00420; HMM-score: 82.6)
    and 2 more
    Ost4; Oligosaccaryltransferase (PF10215; HMM-score: 16)
    DUF2070; Predicted membrane protein (DUF2070) (PF09843; HMM-score: 8.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9994
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0006
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.040897
    • TAT(Tat/SPI): 0.000516
    • LIPO(Sec/SPII): 0.004452
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNLILLLVIGFLVFIGTYMILSINLIRIVIGISIYTHAGNLIIMSMGTYGSSRSEPLITGGNQLFVDPLLQAIVLTAIVIGFGMTAFLLVLVYRTYKVTKEDEIEGLRGEDDAK

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]