From AureoWiki
Revision as of 06:50, 11 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS11050 [old locus tag: SACOL2112 ]
  • symbol: SACOL_RS11050
  • product: 50S ribosomal protein L31 type B
  • replicon: chromosome
  • strand: -
  • coordinates: 2171878..2172132
  • length: 255
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (2171878..2172132) NCBI
  • BioCyc: SACOL_RS11050 BioCyc
  • MicrobesOnline: see SACOL2112

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAACAAGGAATTCATCCTGAGTATCACCAAGTAATCTTTTTAGATACTACTACAAAC
    TTCAAATTCTTAAGCGGTTCTACAAAAACATCTTCAGAAATGATGGAGTGGGAAGATGGA
    AAAGAATACCCAGTTATTCGTTTAGATATTTCATCTGATTCACATCCATTCTACACTGGA
    CGTCAAAAATTCGCTGCTGCGGATGGACGTGTGGAACGTTTCAACAAAAAGTTTGGTCTT
    AAATCAAACAACTAA
    60
    120
    180
    240
    255

Protein[edit | edit source]

Protein Data Bank: 5LI0

General[edit | edit source]

  • locus tag: SACOL_RS11050 [old locus tag: SACOL2112 ]
  • symbol: SACOL_RS11050
  • description: 50S ribosomal protein L31 type B
  • length: 84
  • theoretical pI: 8.95713
  • theoretical MW: 9722.84
  • GRAVY: -0.808333

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL31 (TIGR00105; HMM-score: 72.8)
  • TheSEED: see SACOL2112
  • PFAM:
    L31 (CL0758) Ribosomal_L31; Ribosomal protein L31 (PF01197; HMM-score: 93.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8144
    • Cytoplasmic Membrane Score: 0.1305
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0549
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.010418
    • TAT(Tat/SPI): 0.0005
    • LIPO(Sec/SPII): 0.004755
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKQGIHPEYHQVIFLDTTTNFKFLSGSTKTSSEMMEWEDGKEYPVIRLDISSDSHPFYTGRQKFAAADGRVERFNKKFGLKSNN

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Jump up to: 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]