NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS10295 [old locus tag: SA1792 ]
- pan locus tag?: SAUPAN005101000
- symbol: SA_RS10295
- pan gene symbol?: ssb
- synonym:
- product: single-stranded DNA-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACT
CAAAGTGGTGTAAATGTAGCATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCA
CAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTATTTAAAAAACAAGCAGAGAAC
GTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATT
CAATTTTTAGAACCGAAAAACTCAAATGACACTCAACAAGATTTATATCAACAACAAGTA
CAACAAACACGTGGACAATCGCAATATTCAAATAACAAACCAGTAAAAGATAATCCGTTT
GCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA60
120
180
240
300
360
420
471
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS10295 [old locus tag: SA1792 ]
- symbol: SA_RS10295
- description: single-stranded DNA-binding protein
- length: 156
- theoretical pI: 5.26974
- theoretical MW: 17641.4
- GRAVY: -0.785897
⊟Function[edit | edit source]
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair single-stranded DNA-binding protein (TIGR00621; HMM-score: 153.2)and 1 moreDNA metabolism DNA replication, recombination, and repair primosomal replication protein PriB (TIGR04418; HMM-score: 27.1)
- TheSEED: see SA1792
- PFAM: OB (CL0021) SSB; Single-strand binding protein family (PF00436; HMM-score: 126.5)and 1 moretRNA_anti-codon; OB-fold nucleic acid binding domain (PF01336; HMM-score: 18.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.035423
- TAT(Tat/SPI): 0.008821
- LIPO(Sec/SPII): 0.004455
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTRNYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
SA_RS00690 immunoglobulin G-binding protein A [1] (data from MRSA252) SA_RS02910 50S ribosomal protein L1 [1] (data from MRSA252) SA_RS02955 elongation factor G [1] (data from MRSA252) SA_RS02960 elongation factor Tu [1] (data from MRSA252) SA_RS04140 aldehyde dehydrogenase [1] (data from MRSA252) SA_RS05350 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SA_RS05360 dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex [1] (data from MRSA252) SA_RS05365 dihydrolipoyl dehydrogenase [1] (data from MRSA252) SA_RS06235 elongation factor Ts [1] (data from MRSA252) SA_RS07060 dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex [1] (data from MRSA252) SA_RS11600 30S ribosomal protein S9 [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)