NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS10225 [old locus tag: SA1779 ]
- pan locus tag?: SAUPAN005078000
- symbol: SA_RS10225
- pan gene symbol?: —
- synonym:
- product: HNH endonuclease
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGATGACTAAAGACGAACGTATACGATTCTATAAGTCTAAAGAATGGCAAACAACAAGA
AAAAGAGTACTAGAAAGAGATAATTATGAATGTCAACAATGTAAGAGAGACGGCAAGTTA
ACGACATATGACAAAAGCAAACATAAGTCGTTGGATGTAGATCATATATTATCGCTAGAA
CATCATCCGGAGTTTGCTCATGACTTAAACAATTTAGAAACACTGTGTATTAAATGTCAC
AACAAAAAAGAAAAGAGATTTATAAAAAAAGAAAATAAATGGAAAGACGAAAAATGGTAA60
120
180
240
300
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS10225 [old locus tag: SA1779 ]
- symbol: SA_RS10225
- description: HNH endonuclease
- length: 99
- theoretical pI: 9.7249
- theoretical MW: 12309
- GRAVY: -1.48586
⊟Function[edit | edit source]
- TIGRFAM: decaheme c-type cytochrome, DmsE family (TIGR03508; HMM-score: 18.9)and 1 morecxxc_20_cxxc protein (TIGR04104; HMM-score: 5.8)
- TheSEED: see SA1779
- PFAM: His-Me_finger (CL0263) HNH; HNH endonuclease (PF01844; HMM-score: 37.3)and 5 moreMultiheme_cytos (CL0317) Cytochrome_C7; Cytochrome c7 and related cytochrome c (PF14522; HMM-score: 16.1)Zn_Beta_Ribbon (CL0167) zf-ISL3; zinc-finger of transposase IS204/IS1001/IS1096/IS1165 (PF14690; HMM-score: 14.5)Zn_Tnp_IS1595; Transposase zinc-ribbon domain (PF12760; HMM-score: 13.4)His-Me_finger (CL0263) HNH_5; HNH endonuclease (PF14279; HMM-score: 12.6)Multiheme_cytos (CL0317) Cytochrom_c3_2; Cytochrome c3 (PF14537; HMM-score: 11.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010661
- TAT(Tat/SPI): 0.000654
- LIPO(Sec/SPII): 0.005333
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MMTKDERIRFYKSKEWQTTRKRVLERDNYECQQCKRDGKLTTYDKSKHKSLDVDHILSLEHHPEFAHDLNNLETLCIKCHNKKEKRFIKKENKWKDEKW
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.