NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS10065 [old locus tag: SA1752 ]
- pan locus tag?: SAUPAN005011000
- symbol: SA_RS10065
- pan gene symbol?: hlb-1
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATGGTAAAAAAAACAAAATCCAATTCACTAAAAAAAGTTGCAACACTTGCATTAGCA
AATTTATTATTAGTTGGTGCACTTACTGACAATAGTGCCAAAGCCGAATCTAAGAAAGAT
GATACTGATTTGAAGTTAGTTAGTCATAACGTTTATATGTTATCGACCGTTTTGTATCCA
AACTGGAGACTTTTAACATAA60
120
180
201
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS10065 [old locus tag: SA1752 ]
- symbol: SA_RS10065
- description: hypothetical protein
- length: 66
- theoretical pI: 10.4211
- theoretical MW: 7306.61
- GRAVY: -0.0181818
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Pathogenesis sphingomyelin phosphodiesterase (TIGR03395; EC 3.1.4.12; HMM-score: 14)
- TheSEED: see SA1752
- PFAM:
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 8.8
- Cellwall Score: 0.22
- Extracellular Score: 0.98
- Internal Helices: 0
- LocateP:
- SignalP: Signal peptide SP(Sec/SPI) length 35 aa
- SP(Sec/SPI): 0.954478
- TAT(Tat/SPI): 0.012116
- LIPO(Sec/SPII): 0.02226
- Cleavage Site: CS pos: 35-36. AKA-ES. Pr: 0.9082
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MMVKKTKSNSLKKVATLALANLLLVGALTDNSAKAESKKDDTDLKLVSHNVYMLSTVLYPNWRLLT
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: CodY see SA1752
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.