From AureoWiki
Revision as of 17:38, 12 January 2016 by Robot (talk | contribs) (Created page with "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism</aureodatabase> * <aureodatabase>locus</aureodatabase> * <aureodatabase>pan locus</aur...")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS06050 [old locus tag: SA1067 ]
  • symbol: SA_RS06050
  • product: 50S ribosomal protein L28
  • replicon: chromosome
  • strand: -
  • coordinates: 1207155..1207343
  • length: 189
  • essential: yes DEG other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • gene Genbank : _

Phenotype[edit | edit source]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGGTAAACAATGTTTCGTAACAGGTCGTAAAGCTTCGACTGGTAACAGACGTTCACAC
    GCTTTAAACTCTACTAAACGTAGATGGAACGCTAACCTTCAAAAAGTTAGAATCCTAGTT
    GACGGTAAACCTAAAAAAGTTTGGGTTTCTGCACGTGCTTTAAAATCTGGTAAAGTAACT
    AGAGTTTAA
    60
    120
    180
    189

Protein[edit | edit source]

Protein Data Bank: 4WCE
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5TCU

General[edit | edit source]

  • locus tag: SA_RS06050 [old locus tag: SA1067 ]
  • symbol: SA_RS06050
  • description: 50S ribosomal protein L28
  • length: 62
  • theoretical pI: 12.7454
  • theoretical MW: 6977.18
  • GRAVY: -0.737097

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL28 (TIGR00009; HMM-score: 73.4)
  • TheSEED: see SA1067
  • PFAM:
    no clan defined Ribosomal_L28; Ribosomal L28 family (PF00830; HMM-score: 69.1)
    and 1 more
    DUF348; Domain of unknown function (DUF348) (PF03990; HMM-score: 11.8)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • interaction partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.053732
    • TAT(Tat/SPI): 0.026326
    • LIPO(Sec/SPII): 0.016121
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446440053 NCBI
  • UniProt: see SA1067
  • protein Genbank : _
  • RefSeq: WP_000517908 NCBI

Protein sequence[edit | edit source]

  • MGKQCFVTGRKASTGNRRSHALNSTKRRWNANLQKVRILVDGKPKKVWVSARALKSGKVTRV

Peptides[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • sigma factors : _
  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]