Jump to navigation
Jump to search
(Created page with "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism</aureodatabase> * <aureodatabase>locus</aureodatabase> * <aureodatabase>pan locus</aur...") |
m (Text replacement - "gene Genbank" to "gene RefSeq") |
||
Line 39: | Line 39: | ||
* <aureodatabase>gene GI</aureodatabase> | * <aureodatabase>gene GI</aureodatabase> | ||
* <aureodatabase>gene | * <aureodatabase>gene RefSeq</aureodatabase> | ||
</protect> | </protect> | ||
Revision as of 16:26, 10 March 2016
NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS04775 [old locus tag: SAS025 ]
- pan locus tag?: SAUPAN003126000
- symbol: SA_RS04775
- pan gene symbol?: —
- synonym:
- product: DUF2929 domain-containing protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: WP_000682089 NCBI
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAAACACCTCGTAACATTCTTTTGGGCATTATTATTAATGCAAATGGTTAACTTTGTA
CTTAATAGCCTAGTAGGTGGAGACAGCTTAAATGTAGTGAATCCAATTATCATGGCAGTA
TTGTTCACGATTTTCACAGCAATTTTTGCTGCAGTAATTAAACCGCCGAAAGATTCATCA
CAATAA60
120
180
186
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS04775 [old locus tag: SAS025 ]
- symbol: SA_RS04775
- description: DUF2929 domain-containing protein
- length: 61
- theoretical pI: 9.44367
- theoretical MW: 6753.15
- GRAVY: 1.06885
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SAS025
- PFAM: no clan defined DUF2929; Protein of unknown function (DUF2929) (PF11151; HMM-score: 67.6)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.173747
- TAT(Tat/SPI): 0.001081
- LIPO(Sec/SPII): 0.111387
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKHLVTFFWALLLMQMVNFVLNSLVGGDSLNVVNPIIMAVLFTIFTAIFAAVIKPPKDSSQ
⊟Peptides[edit | edit source]
- experimentally validated:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.