Jump to navigation
Jump to search
(Created page with "<protect> <aureodatabase>NCBI date</aureodatabase> =Summary= * <aureodatabase>organism</aureodatabase> * <aureodatabase>locus</aureodatabase> * <aureodatabase>pan locus</aur...") |
m (Text replacement - "gene Genbank" to "gene RefSeq") |
||
(One intermediate revision by the same user not shown) | |||
Line 1: | Line 1: | ||
__TOC__ | |||
<protect> | <protect> | ||
<aureodatabase> | <aureodatabase>annotation</aureodatabase> | ||
=Summary= | =Summary= | ||
* <aureodatabase>organism</aureodatabase> | *<aureodatabase>organism</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>pan locus</aureodatabase> | *<aureodatabase>pan locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>pan gene symbol</aureodatabase> | *<aureodatabase>pan gene symbol</aureodatabase> | ||
* <aureodatabase>gene synonyms</aureodatabase> | *<aureodatabase>gene synonyms</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
</protect> | </protect> | ||
Line 24: | Line 25: | ||
==General== | ==General== | ||
* <aureodatabase>gene type</aureodatabase> | *<aureodatabase>gene type</aureodatabase> | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>gene symbol</aureodatabase> | *<aureodatabase>gene symbol</aureodatabase> | ||
* <aureodatabase>product</aureodatabase> | *<aureodatabase>product</aureodatabase> | ||
* <aureodatabase>gene replicon</aureodatabase> | *<aureodatabase>gene replicon</aureodatabase> | ||
* <aureodatabase>strand</aureodatabase> | *<aureodatabase>strand</aureodatabase> | ||
* <aureodatabase>gene coordinates</aureodatabase> | *<aureodatabase>gene coordinates</aureodatabase> | ||
* <aureodatabase>gene length</aureodatabase> | *<aureodatabase>gene length</aureodatabase> | ||
* <aureodatabase>essential</aureodatabase> | *<aureodatabase>essential</aureodatabase> | ||
*<aureodatabase>gene comment</aureodatabase> | |||
</protect> | </protect> | ||
Line 38: | Line 40: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>gene | *<aureodatabase>gene location</aureodatabase> | ||
* <aureodatabase>gene | *<aureodatabase>gene BioCyc</aureodatabase> | ||
*<aureodatabase>gene MicrobesOnline</aureodatabase> | |||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Phenotype== | ==Phenotype== | ||
</protect> | </protect> | ||
Share your knowledge and add information here. [<span class="plainlinks">[//aureowiki.med.uni-greifswald.de/index.php?title={{PAGENAMEE}}&veaction=edit§ion=6 edit]</span>] | |||
<protect> | <protect> | ||
==DNA sequence== | ==DNA sequence== | ||
* <aureodatabase>gene sequence</aureodatabase> | *<aureodatabase>gene sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
<aureodatabase>RNA regulated operons</aureodatabase> | |||
</protect> | |||
<protect> | |||
=Protein= | =Protein= | ||
<aureodatabase>protein 3D view</aureodatabase> | <aureodatabase>protein 3D view</aureodatabase> | ||
==General== | ==General== | ||
* <aureodatabase>locus</aureodatabase> | *<aureodatabase>locus</aureodatabase> | ||
* <aureodatabase>protein symbol</aureodatabase> | *<aureodatabase>protein symbol</aureodatabase> | ||
* <aureodatabase>protein description</aureodatabase> | *<aureodatabase>protein description</aureodatabase> | ||
* <aureodatabase>protein length</aureodatabase> | *<aureodatabase>protein length</aureodatabase> | ||
* <aureodatabase>theoretical pI</aureodatabase> | *<aureodatabase>theoretical pI</aureodatabase> | ||
* <aureodatabase>theoretical MW</aureodatabase> | *<aureodatabase>theoretical MW</aureodatabase> | ||
* <aureodatabase>GRAVY</aureodatabase> | *<aureodatabase>GRAVY</aureodatabase> | ||
</protect> | </protect> | ||
Line 71: | Line 77: | ||
==Function== | ==Function== | ||
* <aureodatabase>protein reaction</aureodatabase> | *<aureodatabase>protein reaction</aureodatabase> | ||
* <aureodatabase>protein TIGRFAM</aureodatabase> | *<aureodatabase>protein TIGRFAM</aureodatabase> | ||
* <aureodatabase>protein TheSeed</aureodatabase> | *<aureodatabase>protein TheSeed</aureodatabase> | ||
* <aureodatabase>protein PFAM</aureodatabase> | *<aureodatabase>protein PFAM</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
==Structure, modifications & | ==Structure, modifications & cofactors== | ||
* <aureodatabase>protein domains</aureodatabase> | *<aureodatabase>protein domains</aureodatabase> | ||
* <aureodatabase>protein modifications</aureodatabase> | *<aureodatabase>protein modifications</aureodatabase> | ||
* <aureodatabase>protein cofactors</aureodatabase> | *<aureodatabase>protein cofactors</aureodatabase> | ||
* <aureodatabase>protein effectors</aureodatabase> | *<aureodatabase>protein effectors</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein regulated operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 90: | Line 96: | ||
==Localization== | ==Localization== | ||
* <aureodatabase>protein Psortb</aureodatabase> | *<aureodatabase>protein Psortb</aureodatabase> | ||
* <aureodatabase>protein LocateP</aureodatabase> | *<aureodatabase>protein LocateP</aureodatabase> | ||
* <aureodatabase>protein SignalP</aureodatabase> | *<aureodatabase>protein SignalP</aureodatabase> | ||
* <aureodatabase>protein TMHMM</aureodatabase> | *<aureodatabase>protein TMHMM</aureodatabase> | ||
</protect> | </protect> | ||
Line 99: | Line 105: | ||
==Accession numbers== | ==Accession numbers== | ||
* <aureodatabase>protein GI</aureodatabase> | *<aureodatabase>protein GI</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein RefSeq</aureodatabase> | ||
* <aureodatabase>protein | *<aureodatabase>protein UniProt</aureodatabase> | ||
</protect> | </protect> | ||
Line 108: | Line 113: | ||
==Protein sequence== | ==Protein sequence== | ||
* <aureodatabase>protein sequence</aureodatabase> | *<aureodatabase>protein sequence</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Experimental data== | ||
* <aureodatabase>protein validated peptides</aureodatabase> | *<aureodatabase>protein validated peptides</aureodatabase> | ||
*<aureodatabase>protein validated localization</aureodatabase> | |||
*<aureodatabase>protein validated quantitative data</aureodatabase> | |||
*<aureodatabase>protein partners</aureodatabase> | |||
</protect> | </protect> | ||
Line 125: | Line 133: | ||
==Operon== | ==Operon== | ||
* <aureodatabase>operons</aureodatabase> | *<aureodatabase>operons</aureodatabase> | ||
</protect> | </protect> | ||
Line 131: | Line 139: | ||
==Regulation== | ==Regulation== | ||
*<aureodatabase>regulators</aureodatabase> | |||
* <aureodatabase>regulators</aureodatabase> | |||
</protect> | </protect> | ||
Line 138: | Line 145: | ||
==Transcription pattern== | ==Transcription pattern== | ||
* <aureodatabase>expression browser</aureodatabase> | *<aureodatabase>expression browser</aureodatabase> | ||
</protect> | </protect> | ||
Line 144: | Line 151: | ||
==Protein synthesis (provided by Aureolib)== | ==Protein synthesis (provided by Aureolib)== | ||
* <aureodatabase>protein synthesis Aureolib</aureodatabase> | *<aureodatabase>protein synthesis Aureolib</aureodatabase> | ||
</protect> | </protect> | ||
<protect> | <protect> | ||
== | ==Protein stability== | ||
* <aureodatabase>protein half-life</aureodatabase> | *<aureodatabase>protein half-life</aureodatabase> | ||
</protect> | </protect> | ||
Latest revision as of 15:31, 10 March 2016
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS04695 [old locus tag: SA0826 ]
- pan locus tag?: SAUPAN003074000
- symbol: SA_RS04695
- pan gene symbol?: spsB
- synonym:
- product: signal peptidase IB
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541TTGAAAAAAGAATTATTGGAATGGATTATTTCAATTGCAGTCGCTTTTGTCATTTTATTT
ATAGTAGGTAAATTTATTGTTACACCATATACAATTAAAGGTGAATCAATGGATCCAACT
TTGAAAGATGGCGAGCGAGTAGCTGTAAACATTATTGGATATAAAACAGGTGGTTTGGAA
AAAGGTAATGTAGTTGTCTTCCATGCAAACAAAAATGATGACTATGTTAAACGTGTCATC
GGTGTTCCTGGTGATAAAGTAGAATATAAAAATGATACATTATATGTCAATGGTAAAAAA
CAAGATGAACCATATTTAAACTATAATTTAAAACATAAACAAGGTGATTACATTACTGGG
ACTTTCCAAGTTAAAGATTTACCGAATGCGAATCCTAAATCAAATGTCATTCCAAAAGGT
AAATATTTAGTTCTTGGAGATAATCGTGAAGTAAGTAAAGATAGCCGTGCGTTTGGCCTC
ATTGATGAAGACCAAATTGTTGGTAAAGTTTCATTTAGATTCTGGCCATTTAGTGAATTT
AAACATAATTTCAATCCTGAAAATACTAAAAATTAA60
120
180
240
300
360
420
480
540
576
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS04695 [old locus tag: SA0826 ]
- symbol: SA_RS04695
- description: signal peptidase IB
- length: 191
- theoretical pI: 9.53343
- theoretical MW: 21691.7
- GRAVY: -0.436126
⊟Function[edit | edit source]
- reaction: EC 3.4.21.89? ExPASySignal peptidase I Cleavage of hydrophobic, N-terminal signal or leader sequences from secreted and periplasmic proteins
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking signal peptidase I (TIGR02227; EC 3.4.21.89; HMM-score: 178)and 4 moreCellular processes Detoxification nickel-type superoxide dismutase maturation protease (TIGR02754; EC 3.4.21.-; HMM-score: 49.8)Protein fate Protein modification and repair nickel-type superoxide dismutase maturation protease (TIGR02754; EC 3.4.21.-; HMM-score: 49.8)conjugative transfer signal peptidase TraF (TIGR02771; HMM-score: 36.4)signal peptidase I (TIGR02228; EC 3.4.21.89; HMM-score: 29.1)
- TheSEED: see SA0826
- PFAM: Peptidase_SF (CL0299) Peptidase_S24; Peptidase S24-like (PF00717; HMM-score: 72.8)and 1 morePeptidase_S26; Signal peptidase, peptidase S26 (PF10502; HMM-score: 36.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cellwall
- Cytoplasmic Score: 0.01
- Cytoplasmic Membrane Score: 0.53
- Cellwall Score: 8.75
- Extracellular Score: 0.7
- Internal Helix: 1
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.279228
- TAT(Tat/SPI): 0.000866
- LIPO(Sec/SPII): 0.048246
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKELLEWIISIAVAFVILFIVGKFIVTPYTIKGESMDPTLKDGERVAVNIIGYKTGGLEKGNVVVFHANKNDDYVKRVIGVPGDKVEYKNDTLYVNGKKQDEPYLNYNLKHKQGDYITGTFQVKDLPNANPKSNVIPKGKYLVLGDNREVSKDSRAFGLIDEDQIVGKVSFRFWPFSEFKHNFNPENTKN
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
SA_RS11130 (deoA) pyrimidine-nucleoside phosphorylase [1] (data from MRSA252) SA_RS09855 (gatA) glutamyl-tRNA(Gln) amidotransferase subunit A [1] (data from MRSA252) SA_RS00150 DNA polymerase III subunit beta [1] (data from MRSA252) SA_RS00170 DNA gyrase subunit A [1] (data from MRSA252) SA_RS00310 aminoglycoside O-nucleotidyltransferase ANT(4')-Ia [1] (data from MRSA252) SA_RS00690 immunoglobulin G-binding protein A [1] (data from MRSA252) SA_RS00835 2-deoxyribose-5-phosphate aldolase [1] (data from MRSA252) SA_RS01275 formate acetyltransferase [1] (data from MRSA252) SA_RS01365 L-lactate dehydrogenase [1] (data from MRSA252) SA_RS02015 30S ribosomal protein S6 [1] (data from MRSA252) SA_RS02025 30S ribosomal protein S18 [1] (data from MRSA252) SA_RS02095 alkyl hydroperoxide reductase subunit C [1] (data from MRSA252) SA_RS02145 IMP dehydrogenase [1] (data from MRSA252) SA_RS02150 GMP synthase (glutamine-hydrolyzing) [1] (data from MRSA252) SA_RS02405 methionine ABC transporter substrate-binding protein [1] (data from MRSA252) SA_RS02650 50S ribosomal protein L25/general stress protein Ctc [1] (data from MRSA252) SA_RS02685 RNA-binding protein S1 [1] (data from MRSA252) SA_RS02710 cysteine synthase [1] (data from MRSA252) SA_RS02810 pyridoxal 5'-phosphate synthase lyase subunit PdxS [1] (data from MRSA252) SA_RS02840 ATP-dependent Clp protease ATP-binding subunit ClpC [1] (data from MRSA252) SA_RS02905 50S ribosomal protein L11 [1] (data from MRSA252) SA_RS02910 50S ribosomal protein L1 [1] (data from MRSA252) SA_RS02915 50S ribosomal protein L10 [1] (data from MRSA252) SA_RS02920 50S ribosomal protein L7/L12 [1] (data from MRSA252) SA_RS02930 DNA-directed RNA polymerase subunit beta [1] (data from MRSA252) SA_RS02935 DNA-directed RNA polymerase subunit beta' [1] (data from MRSA252) SA_RS02950 30S ribosomal protein S7 [1] (data from MRSA252) SA_RS02955 elongation factor G [1] (data from MRSA252) SA_RS02960 elongation factor Tu [1] (data from MRSA252) SA_RS03115 hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [1] (data from MRSA252) SA_RS03380 metal ABC transporter substrate-binding protein [1] (data from MRSA252) SA_RS03910 ribonucleotide-diphosphate reductase subunit alpha [1] (data from MRSA252) SA_RS04020 ribosomal subunit interface protein [1] (data from MRSA252) SA_RS04140 aldehyde dehydrogenase [1] (data from MRSA252) SA_RS04145 phosphoglycerate kinase [1] (data from MRSA252) SA_RS04155 2,3-bisphosphoglycerate-independent phosphoglycerate mutase [1] (data from MRSA252) SA_RS04160 enolase [1] (data from MRSA252) SA_RS04420 ABC transporter ATP-binding protein [1] (data from MRSA252) SA_RS04575 NADH dehydrogenase [1] (data from MRSA252) SA_RS04680 glucose-6-phosphate isomerase [1] (data from MRSA252) SA_RS04710 hypothetical protein [1] (data from MRSA252) SA_RS04785 beta-ketoacyl-[acyl-carrier-protein] synthase II [1] (data from MRSA252) SA_RS04845 tryptophan--tRNA ligase [1] (data from MRSA252) SA_RS04935 hypothetical protein [1] (data from MRSA252) SA_RS05295 phosphocarrier protein HPr [1] (data from MRSA252) SA_RS05300 phosphoenolpyruvate--protein phosphotransferase [1] (data from MRSA252) SA_RS05350 pyruvate dehydrogenase E1 component subunit alpha [1] (data from MRSA252) SA_RS05355 pyruvate dehydrogenase E1 component subunit beta [1] (data from MRSA252) SA_RS05365 dihydrolipoyl dehydrogenase [1] (data from MRSA252) SA_RS05860 cell division protein FtsZ [1] (data from MRSA252) SA_RS06060 hypothetical protein [1] (data from MRSA252) SA_RS06085 beta-ketoacyl-ACP reductase [1] (data from MRSA252) SA_RS06125 30S ribosomal protein S16 [1] (data from MRSA252) SA_RS06140 50S ribosomal protein L19 [1] (data from MRSA252) SA_RS06165 succinyl-CoA ligase subunit beta [1] (data from MRSA252) SA_RS06225 30S ribosomal protein S2 [1] (data from MRSA252) SA_RS06235 elongation factor Ts [1] (data from MRSA252) SA_RS06295 translation initiation factor IF-2 [1] (data from MRSA252) SA_RS06320 polyribonucleotide nucleotidyltransferase [1] (data from MRSA252) SA_RS06955 ABC transporter ATP-binding protein [1] (data from MRSA252) SA_RS07005 cold-shock protein CspA [1] (data from MRSA252) SA_RS07060 dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex [1] (data from MRSA252) SA_RS07065 2-oxoglutarate dehydrogenase E1 component [1] (data from MRSA252) SA_RS07210 alanine dehydrogenase [1] (data from MRSA252) SA_RS07400 30S ribosomal protein S1 [1] (data from MRSA252) SA_RS07605 phosphogluconate dehydrogenase (NADP(+)-dependent, decarboxylating) [1] (data from MRSA252) SA_RS07695 elongation factor P [1] (data from MRSA252) SA_RS07725 glycine dehydrogenase [1] (data from MRSA252) SA_RS07880 glycine--tRNA ligase [1] (data from MRSA252) SA_RS07955 molecular chaperone DnaK [1] (data from MRSA252) SA_RS08295 50S ribosomal protein L21 [1] (data from MRSA252) SA_RS08435 trigger factor [1] (data from MRSA252) SA_RS08460 50S ribosomal protein L20 [1] (data from MRSA252) SA_RS08470 translation initiation factor IF-3 [1] (data from MRSA252) SA_RS08480 threonine--tRNA ligase [1] (data from MRSA252) SA_RS08505 aldehyde dehydrogenase [1] (data from MRSA252) SA_RS08545 isocitrate dehydrogenase (NADP(+)) [1] (data from MRSA252) SA_RS08560 pyruvate kinase [1] (data from MRSA252) SA_RS08625 universal stress protein UspA [1] (data from MRSA252) SA_RS08630 acetate kinase [1] (data from MRSA252) SA_RS08640 2-Cys peroxiredoxin [1] (data from MRSA252) SA_RS08675 30S ribosomal protein S4 [1] (data from MRSA252) SA_RS08760 formate--tetrahydrofolate ligase [1] (data from MRSA252) SA_RS08860 D-alanine aminotransferase [1] (data from MRSA252) SA_RS08865 dipeptidase PepV [1] (data from MRSA252) SA_RS09005 transaldolase [1] (data from MRSA252) SA_RS09710 glutamine amidotransferase [1] (data from MRSA252) SA_RS09810 non-heme ferritin [1] (data from MRSA252) SA_RS09960 manganese-dependent inorganic pyrophosphatase [1] (data from MRSA252) SA_RS10010 thioredoxin family protein [1] (data from MRSA252) SA_RS11010 uracil phosphoribosyltransferase [1] (data from MRSA252) SA_RS11050 50S ribosomal protein L31 type B [1] (data from MRSA252) SA_RS11060 aldehyde dehydrogenase family protein [1] (data from MRSA252) SA_RS11070 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [1] (data from MRSA252) SA_RS11075 fructose-bisphosphate aldolase [1] (data from MRSA252) SA_RS11145 purine-nucleoside phosphorylase [1] (data from MRSA252) SA_RS11245 glutamine--fructose-6-phosphate aminotransferase [1] (data from MRSA252) SA_RS11430 Asp23/Gls24 family envelope stress response protein [1] (data from MRSA252) SA_RS11600 30S ribosomal protein S9 [1] (data from MRSA252) SA_RS11605 50S ribosomal protein L13 [1] (data from MRSA252) SA_RS11630 50S ribosomal protein L17 [1] (data from MRSA252) SA_RS11635 DNA-directed RNA polymerase subunit alpha [1] (data from MRSA252) SA_RS11640 30S ribosomal protein S11 [1] (data from MRSA252) SA_RS11645 30S ribosomal protein S13 [1] (data from MRSA252) SA_RS11670 50S ribosomal protein L15 [1] (data from MRSA252) SA_RS11675 50S ribosomal protein L30 [1] (data from MRSA252) SA_RS11680 30S ribosomal protein S5 [1] (data from MRSA252) SA_RS11685 50S ribosomal protein L18 [1] (data from MRSA252) SA_RS11690 50S ribosomal protein L6 [1] (data from MRSA252) SA_RS11695 30S ribosomal protein S8 [1] (data from MRSA252) SA_RS11705 50S ribosomal protein L5 [1] (data from MRSA252) SA_RS11725 50S ribosomal protein L29 [1] (data from MRSA252) SA_RS11730 50S ribosomal protein L16 [1] (data from MRSA252) SA_RS11735 30S ribosomal protein S3 [1] (data from MRSA252) SA_RS11740 50S ribosomal protein L22 [1] (data from MRSA252) SA_RS11745 30S ribosomal protein S19 [1] (data from MRSA252) SA_RS11750 50S ribosomal protein L2 [1] (data from MRSA252) SA_RS11755 50S ribosomal protein L23 [1] (data from MRSA252) SA_RS11760 50S ribosomal protein L4 [1] (data from MRSA252) SA_RS11770 30S ribosomal protein S10 [1] (data from MRSA252) SA_RS13705 L-lactate dehydrogenase [1] (data from MRSA252) SA_RS13730 class I fructose-bisphosphate aldolase [1] (data from MRSA252) SA_RS13735 malate:quinone oxidoreductase [1] (data from MRSA252) SA_RS13915 ornithine carbamoyltransferase [1] (data from MRSA252) SA_RS13920 arginine deiminase [1] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.000 1.001 1.002 1.003 1.004 1.005 1.006 1.007 1.008 1.009 1.010 1.011 1.012 1.013 1.014 1.015 1.016 1.017 1.018 1.019 1.020 1.021 1.022 1.023 1.024 1.025 1.026 1.027 1.028 1.029 1.030 1.031 1.032 1.033 1.034 1.035 1.036 1.037 1.038 1.039 1.040 1.041 1.042 1.043 1.044 1.045 1.046 1.047 1.048 1.049 1.050 1.051 1.052 1.053 1.054 1.055 1.056 1.057 1.058 1.059 1.060 1.061 1.062 1.063 1.064 1.065 1.066 1.067 1.068 1.069 1.070 1.071 1.072 1.073 1.074 1.075 1.076 1.077 1.078 1.079 1.080 1.081 1.082 1.083 1.084 1.085 1.086 1.087 1.088 1.089 1.090 1.091 1.092 1.093 1.094 1.095 1.096 1.097 1.098 1.099 1.100 1.101 1.102 1.103 1.104 1.105 1.106 1.107 1.108 1.109 1.110 1.111 1.112 1.113 1.114 1.115 1.116 1.117 1.118 1.119 1.120 1.121 1.122 1.123 1.124 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)