NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS02940 [old locus tag: SA0502 ]
- pan locus tag?: SAUPAN002316000
- symbol: SA_RS02940
- pan gene symbol?: rplGB
- synonym:
- product: 50S ribosomal protein L7ae-like protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
- Gene ID:
- gene Genbank : _
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241TTGTCTAAGGAAAAAGTTGCACGCTTTAACAAACAACATTTTGTAGTTGGTCTTAAAGAA
ACGCTTAAAGCGTTAAAGAAAGATCAAGTTACATCTTTGATTATTGCTGAAGACGTTGAA
GTATATTTAATGACTCGCGTGTTAAGCCAAATCAATCAGAAAAATATACCTGTATCTTTT
TTCAAAAGCAAACATGCTTTGGGTAAACATGTAGGTATTAACGTCAATGCGACAATAGTA
GCATTGATTAAATGA60
120
180
240
255
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS02940 [old locus tag: SA0502 ]
- symbol: SA_RS02940
- description: 50S ribosomal protein L7ae-like protein
- length: 84
- theoretical pI: 10.8182
- theoretical MW: 9446.19
- GRAVY: 0.0607143
⊟Function[edit | edit source]
- TIGRFAM: ribosomal protein eL8 (TIGR03677; HMM-score: 37.8)
- TheSEED: see SA0502
- PFAM: PELOTA (CL0101) Ribosomal_L7Ae; Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248; HMM-score: 39.1)and 3 moreeRF1_3; eRF1 domain 3 (PF03465; HMM-score: 16.5)no clan defined DUF1694; Protein of unknown function (DUF1694) (PF07997; HMM-score: 13.8)Cas_Cas1; CRISPR associated protein Cas1 (PF01867; HMM-score: 13)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001767
- TAT(Tat/SPI): 0.000214
- LIPO(Sec/SPII): 0.00029
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSKEKVARFNKQHFVVGLKETLKALKKDQVTSLIIAEDVEVYLMTRVLSQINQKNIPVSFFKSKHALGKHVGINVNATIVALIK
⊟Peptides[edit | edit source]
- experimentally validated:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.