COLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS02730
- pan locus tag?:
- symbol: SA_RS02730
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS02730
- symbol: SA_RS02730
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 547426..547518
- length: 93
- essential: unknown
⊟Accession numbers[edit | edit source]
- Gene ID:
- gene Genbank : _
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61ATGGTTAATGATAAAGTATTAGAAACATCGAAAGAGATGTATGTTGAGCAAAAATGTCTG
ATATTTTATAAAACTTTAAAGGAAAATGTTTGA60
93
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS02730
- symbol: SA_RS02730
- description: hypothetical protein
- length: 30
- theoretical pI: 6.51244
- theoretical MW: 3624.27
- GRAVY: -0.35
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM:
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.128888
- TAT(Tat/SPI): 0.008737
- LIPO(Sec/SPII): 0.04246
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MVNDKVLETSKEMYVEQKCLIFYKTLKENV
⊟Peptides[edit | edit source]
- experimentally validated:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.