NCBI date : _
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS02685 [old locus tag: SA0466 ]
- pan locus tag?: SAUPAN002249000
- symbol: SA_RS02685
- pan gene symbol?: —
- synonym:
- product: RNA-binding protein S1
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: WP_000021445 NCBI
⊟Phenotype[edit | edit source]
- Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTCAATCGAAGTTGGAAATAAGCTTAAAGGTAAAGTCACTGGTATTAAAAAGTTTGGT
GCATTCGTAGAATTACCTGAAGGAAAAAGTGGTTTAGTTCACATTAGTGAAGTCGCAGAT
AATTATGTTGAAAACGTAGAAGAGCACCTTTCTGTTGGTGATGAAGTAGACGTGAAAGTA
TTATCTATTGCTGATGATGGAAAAATTAGTCTTTCAATTAAGAAAGCTAAAGACCGTCCA
CGTAGACAACATACGAGTAAACCAAGTCATCAAAAACCAGTGCAAAAAGCCGAAGATTTT
GAAAAGAAATTAAGCAATTTCTTAAAAGATAGTGAAGATAAATTAACTTCAATCAAACGT
CAAACAGAATCTAGACGCGGTGGCAAAGGTTCTAGACGTTAA60
120
180
240
300
360
402
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS02685 [old locus tag: SA0466 ]
- symbol: SA_RS02685
- description: RNA-binding protein S1
- length: 133
- theoretical pI: 10.3587
- theoretical MW: 14811.7
- GRAVY: -0.873684
⊟Function[edit | edit source]
- TIGRFAM: Transcription Degradation of RNA polyribonucleotide nucleotidyltransferase (TIGR03591; EC 2.7.7.8; HMM-score: 75.4)Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bS1 (TIGR00717; HMM-score: 69.5)and 7 moreguanosine pentaphosphate synthetase I/polyribonucleotide nucleotidyltransferase (TIGR02696; EC 2.7.-.-,2.7.7.8; HMM-score: 47.4)Transcription Degradation of RNA ribonuclease R (TIGR02063; EC 3.1.-.-; HMM-score: 36.6)Transcription Degradation of RNA VacB and RNase II family 3'-5' exoribonucleases (TIGR00358; EC 3.1.13.1; HMM-score: 24.2)Transcription Degradation of RNA ribonuclease, Rne/Rng family (TIGR00757; EC 3.1.4.-; HMM-score: 18.6)Transcription DNA-dependent RNA polymerase DNA-directed RNA polymerase (TIGR00448; EC 2.7.7.6; HMM-score: 18.3)Energy metabolism Glycolysis/gluconeogenesis carbon storage regulator (TIGR00202; HMM-score: 14.2)Regulatory functions RNA interactions carbon storage regulator (TIGR00202; HMM-score: 14.2)
- TheSEED: see SA0466
- PFAM: OB (CL0021) S1; S1 RNA binding domain (PF00575; HMM-score: 74.6)and 2 moreS1_2; S1 domain (PF13509; HMM-score: 14.2)no clan defined CsrA; Global regulator protein family (PF02599; HMM-score: 12.7)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- interaction partners:
SA_RS02015 30S ribosomal protein S6 [1] (data from MRSA252) SA_RS02910 50S ribosomal protein L1 [1] (data from MRSA252) SA_RS02915 50S ribosomal protein L10 [1] (data from MRSA252) SA_RS02920 50S ribosomal protein L7/L12 [1] (data from MRSA252) SA_RS06140 50S ribosomal protein L19 [1] (data from MRSA252) SA_RS06315 30S ribosomal protein S15 [1] (data from MRSA252) SA_RS07385 DNA-binding protein HU [1] (data from MRSA252) SA_RS08295 50S ribosomal protein L21 [1] (data from MRSA252) SA_RS08560 pyruvate kinase [1] (data from MRSA252) SA_RS08600 universal stress protein [1] (data from MRSA252) SA_RS08675 30S ribosomal protein S4 [1] (data from MRSA252) SA_RS11640 30S ribosomal protein S11 [1] (data from MRSA252) SA_RS11670 50S ribosomal protein L15 [1] (data from MRSA252) SA_RS11680 30S ribosomal protein S5 [1] (data from MRSA252) SA_RS11705 50S ribosomal protein L5 [1] (data from MRSA252) SA_RS11720 30S ribosomal protein S17 [1] (data from MRSA252) SA_RS11730 50S ribosomal protein L16 [1] (data from MRSA252) SA_RS11740 50S ribosomal protein L22 [1] (data from MRSA252) SA_RS11750 50S ribosomal protein L2 [1] (data from MRSA252) SA_RS11755 50S ribosomal protein L23 [1] (data from MRSA252) SA_RS11760 50S ribosomal protein L4 [1] (data from MRSA252) SA_RS11765 50S ribosomal protein L3 [1] (data from MRSA252) SA_RS12200 LysR family transcriptional regulator [1] (data from MRSA252)
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002975
- TAT(Tat/SPI): 0.000161
- LIPO(Sec/SPII): 0.000482
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSIEVGNKLKGKVTGIKKFGAFVELPEGKSGLVHISEVADNYVENVEEHLSVGDEVDVKVLSIADDGKISLSIKKAKDRPRRQHTSKPSHQKPVQKAEDFEKKLSNFLKDSEDKLTSIKRQTESRRGGKGSRR
⊟Peptides[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- sigma factors : _
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)