From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS01660 [old locus tag: SA0285 ]
  • pan locus tag?: SAUPAN001197000
  • symbol: SA_RS01660
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS01660 [old locus tag: SA0285 ]
  • symbol: SA_RS01660
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 342835..343053
  • length: 219
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (342835..343053) NCBI
  • BioCyc: SA_RS01660 BioCyc
  • MicrobesOnline: see SA0285

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGAAAACCAAAAACAAGGCAATGGCTTAAAAATTGCAACATGGGTATTTATTGTATTA
    ACAGTAGTTACACCGCTATTTGGTATTGGAAGTATTGTTTGTAGTATTAATTATAAAAAA
    TACGATGCTGAAAAAGGTTCGAAGTTATTGCAAATTGCAATTATCGTAACAATAATTGCT
    TTTGTTTTAAATTTATTAGCATATTTAGGTTTAAGATAA
    60
    120
    180
    219

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS01660 [old locus tag: SA0285 ]
  • symbol: SA_RS01660
  • description: hypothetical protein
  • length: 72
  • theoretical pI: 9.97598
  • theoretical MW: 7926.51
  • GRAVY: 0.795833

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SA0285
  • PFAM:
    no clan defined DUF4293; Domain of unknown function (DUF4293) (PF14126; HMM-score: 18.3)
    AWPM-19; AWPM-19-like family (PF05512; HMM-score: 16.5)
    and 3 more
    RTA1; RTA1 like protein (PF04479; HMM-score: 13.6)
    DUF4282; Domain of unknown function (DUF4282) (PF14110; HMM-score: 13)
    C_Lectin (CL0056) Chordopox_A33R; Chordopoxvirus A33R protein (PF05966; HMM-score: 12.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.026764
    • TAT(Tat/SPI): 0.000431
    • LIPO(Sec/SPII): 0.187649
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MENQKQGNGLKIATWVFIVLTVVTPLFGIGSIVCSINYKKYDAEKGSKLLQIAIIVTIIAFVLNLLAYLGLR

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]